ISPko6

  • Family IS6
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
ND Paracoccus kondratievae
Paracoccus kondratievae NCIBM 13773
DNA section
IS Length : 817 bp

Ends


IR Length : 15/19

IRL : GGCAGTGTCGCAAAGTTTCTGGTTCTTCGATGACCTTTGATATGCCATTG
IRR : GGTTTTGTCGCAAATTTCCAAACAGTCTGAAAGGGTCTGAGCGCTGGACA

Insertion site


Left flankDirect repeatRight flankDR Length
CAGCTTGTCGTCTCCGAGGG0
GTTGCGTCGTGGCGCTGACA0
TTCAGCGCGGTTCCTACGCG0
TTGCGTATCACCTTCGGGCG0
TACAAAATATGTGCGTCTTC0
CATCTCCGAGGGCCCGGCTG0
TCGCTTGTAGCTCGGATGAA0

DNA sequence

GGCAGTGTCGCAAAGTTTCTGGTTCTTCGATGACCTTTGATATGCCATTGTTTTCGGGTAGTTGGGGAGAGGCTCGGGGCGTGATCGAATTCAAGGGCGT
GCATTATCCGAAGTCGGTGATCCTTTACGCGGTGTTCTTTTATGTTCGCTATGCCGTCTCCTATCGTGATCTTGAGGAAATTCTCGGTGAGCGGGGCGTC
ACGGTAGACCACGCCACGCTGAACCGCTGGGTGGTGAAATTCGCTCCGCTGATCGCCGCGAGGGCACAAGCCAGGAAACGACCGACGGCTAGCTCTTGGC
GGATGGATGAAACATACATCAAGGTGAAGGGCCGTTGGTGCTACCTCTATCGCGCTGTGGATCGCGACGGGCAAACGCTCGACTTCATGCTTGCTGAACG
GCGCGATTTCACCGCCGCCCGGCGCTTCTTCAAGCAGGCCATAGAAACGCACGGCGTGCCCGAGAGGGTTGTCATCGACAAGAGCGGCGCCAATCTGGCG
GGCCTTGAGGCGGTGAACGTGATCCTGAAATTCACCGGCATTGGTCGAATGATCGAGGTCCGGCAGGTCAAGTATCTGAACAACATCATTGAGCAAGACC
ATCGCTTCATCAAGCGGATCACGCGGCCAATGATGGGCTTCAAGGCCTTCCATTCGGCCATCGCCACAGTCGCCGGGATCGAGACCGCGCACATGATACG
CAAGGGGCAGATCCCGGCTAACGGTGCCTCGGCGTTCCAGACCTTTGCGAGGCTCGCTGCATAATTATGTCCAGCGCTCAGACCCTTTCAGACTGTTTGG
AAATTTGCGACAAAACC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
684 bp227 aa81764+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

VIEFKGVHYPKSVILYAVFFYVRYAVSYRDLEEILGERGVTVDHATLNRWVVKFAPLIAARAQARKRPTASSWRMDETYIKVKGRWCYLYRAVDRDGQTL
DFMLAERRDFTAARRFFKQAIETHGVPERVVIDKSGANLAGLEAVNVILKFTGIGRMIEVRQVKYLNNIIEQDHRFIKRITRPMMGFKAFHSAIATVAGI
ETAHMIRKGQIPANGASAFQTFARLAA

 

Blast result :
Comments
ISPko6 is 84% aa similar to IS2020.
ISPko6 was identified by in silico nucleotide sequence analysis of Paracoccus kondratievae plasmid pKON1 (95 kb). This IS is present in 7 copies in the pKON1 genome (2 copies of ISPko6 and 5 isoforms: ISPko6a, ISPko6b, ISPko6c, ISPko6d, ISPko6e, one copy each).
References
1] Czarnecki J. (2015) Direct submission