ISPko7

  • Family IS110
  • Group IS1111
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
ND Paracoccus kondratievae
Paracoccus kondratievae NCIBM 13773
DNA section
IS Length : 1140 bp

Ends


IR Length : 11/12

IRL : gcctctgTGCGCCAAGGTGGGTCTGCAATGATCCACAAAGGAGAGCGGTC
IRR : ----tatTGCGCCAAGCTGCTCCTTGCCCTCTTACGCTCCGACCTCCTCG

Insertion site


Left flankDirect repeatRight flankDR Length
CCCCCCGACGGTCGTGAGAC0

DNA sequence

GCCTCTGTGCGCCAAGGTGGGTCTGCAATGATCCACAAAGGAGAGCGGTCATGTCTGAGATTATCACGGTCGGACTCGATTTGGCGAAGAATGTGTTTCA
GGTTCACGGGGCCGACGCTGCGGGCCGGGCGGTGCTGCGCAAGAAGCTGAGAAGAGACCAGGTCCTGGCATTCTTCGGACAGCTTCCGGCCTGCGTTGTC
GCGATGGAAGCCTGTGGCGGCGCCCATTTCTGGGGGCGTGAGATCGGGAAGATCGGGCATGAGGTGCGGCTGATCCCACCCGCCTACGTGAAGCCATTCG
TGAAGCGCCAGAAGAATGACATGGCCGATGCCGAAGCAATCTGCGAGGCGGCGCAGCGCCCGACGATGCGCTTCGTGCCGGTGAAGAGCGAGGAGACCCA
GGGCGCTGCAATGGTCTTTCGCATCCGCGAGTTGCTGATCCGGCAGAGAACCCAGGCCATCAATGCCCTGCGCGGGCATTTGGGCGAGTTCGGAAAGATC
GTGCCGCAGGGCGCGGCTAACGTGTCGAAGCTGATTGCCATTGTGGAAGATCCGGAAGGCGGTCTGCCTGCCGATGCCATCCCCACGCTCAAGGTGCTGG
TCGCGACCCTCGCCCATCTCGAGGCGGAGATCAGCAAGCTCGATACCGAGATCGCCCGGTGTGCCCAGGACAATGAGGTGGCGCGGCGGCTGATGACAGT
CCCGGGGATAGGTCCTCTGATTGCCACGGCCATCGCAGTCCTGGCTCCGCCCCCCGAGACGTTCCGCAAGGCGCGCGATTTTGCGGCTTGGCTCGGCCTC
ACACCCCGTCAGCATTCCACAGGCGGCAAGCAGCGCCTTGGGGCCACGACAAGGATGGGCGAACGGTCTTTGCGGCGCCTCCTGATCATTGGCGCCAACA
GCGTCATCATCAAACGCCATGTCCATGCTGCGGCCCGGCCGGGAACTTGGCTGGGCGGGATGCTGACGCGCAAGCCGCCGATGCTGGTGCGGGTCGCGCT
GGCGAACAAGATGGCGCGGATCGTCTGGGCTCTGATGGCCCGGGGTGGCGTCTACAAGGCTCCGGCTACGGCGGCGTAAGCCGTCCGTCAGTCGCGAGGA
GGTCGGAGCGTAAGAGGGCAAGGAGCAGCTTGGCGCAATA
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1029 bp342 aa511079+No
ORF function : Transposase
Chemistry : DEDD

ORF sequence :

MSEIITVGLDLAKNVFQVHGADAAGRAVLRKKLRRDQVLAFFGQLPACVVAMEACGGAHFWGREIGKIGHEVRLIPPAYVKPFVKRQKNDMADAEAICEA
AQRPTMRFVPVKSEETQGAAMVFRIRELLIRQRTQAINALRGHLGEFGKIVPQGAANVSKLIAIVEDPEGGLPADAIPTLKVLVATLAHLEAEISKLDTE
IARCAQDNEVARRLMTVPGIGPLIATAIAVLAPPPETFRKARDFAAWLGLTPRQHSTGGKQRLGATTRMGERSLRRLLIIGANSVIIKRHVHAAARPGTW
LGGMLTRKPPMLVRVALANKMARIVWALMARGGVYKAPATAA

 

Blast result :
Comments
ISPko7 is 78% aa similar to ISMtsp17.
ISPko7 was identified by in silico nucleotide sequence analysis of Paracoccus kondratievae plasmid pKON1 (95 kb). This IS is present in 1 copy in the pKON1 genome.
References
1] Czarnecki J. (2015) Direct submission