ISPa49

  • Family IS110
  • Group IS1111
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
ND Pseudomonas aeruginosa
Pseudomonas aeruginosa DSM1128
DNA section
IS Length : 1417 bp

Ends


IR Length : 13

IRL : aaatgtaATGGACGCCTCCCTCTTACATCCTTCCGGCTCCAGCCTCGAGG
IRR : ----tatATGGACGCCTCCCGTTTGCCAAGAACGTCTTCGGTGATGGTGT

Insertion site


Left flankDirect repeatRight flankDR Length
CGCGTGGAGGCTACTGATGC0
CGCACGGAGGCTATTGATGG0

DNA sequence

AAATGTAATGGACGCCTCCCTCTTACATCCTTCCGGCTCCAGCCTCGAGGCGGATCAGGCCTAGAGGGCCGTGATACATCTGGAGCTCCGTAGCCCACCT
GGAGAGATCATCATGAGCCTTTCCCAAACCATCGTTGGCATCGATATAGCCAAGAGCGTCTTCCAGATTCACGAGGTAGACAAAGAAACAGGAGAAGTTA
CCAGCCGCCAGATTAAGCGCGCTCGTCTCCTGCAGCACTTCATCAATCGCGAGCCATGCTTCATCGGCATGGAGGCGTGTGGTGGGGCGCAGCATTGGGC
CCGCCAGTTTGTAGCCATGGGGCACACCGTGAAACTGCTCCCGGCTCAGTCGGTGCGCCCCTTCGCAGGCGGTAACAAGAATGACGTTGCAGATGCACGA
GCTATCTGGATAGCCGTTCAACAACCGGGAATCAAAGCCGTTGCAATCAAGACCGAAGCGCAGCAGGCCGTGCTCGCGCTCCATCGTATGCGGCAGCAAC
TGGTGAAATTTCGTACCGCACAGATCAATGCCTTGCGTGGGCTACTCGCTGAATACGGTGAGGTCATGCCCCTGGGCCGCGATGCAGTAGCCAAGGCGCT
GCCTTCGGTATTCGCCCGGCTCGTCGATCGCCTTCCGGGAGTCTTGATTGAATCACTGCGCGAGCAGTACACGCGAATCGCTCAATTGGACAAAGAAGTT
TCCAACATCGAGCGTCGGCTGCGGGAGTGGCACCGCGACGACGAAAGTTGCCGGCGCATAACGGCAATTCCCGGTGTGGGGTTGCTCACCGCTACCGCCA
CGGTTGCCGCCATGGGGGATCCAGGTGCATTCAGCTCTGGCCGCGAATTCGCTGCCTGGCTGGGCTTGGTTCCTCGGCAGACCGGAACAGGTGGCCGGGT
AAAACTCCTGGGTATCAGTAAGCGAGGCGATAGGTATCTACGCACGCTTCTTATCCATGGCGCTCGGTCAGTTCTGATGACGAGCAAAACACCGCCCGCA
TGGGCAGCGAATTTGGCTACGCGACGCCCACTGAATGTAGCCGTGGTGGCACTGGCCAACAAGATGGCTCGTACGTTGTGGGCCTTACTGGCTCACCAAC
GAGTGTTCCAACCTGAGTACGTAAGTCGACCCGCTTGAGCCGGTCACGCTTGCATTTATTTACTTCGATATAGGGAGGACAGCTGAAAGGTTGCGCAAGG
TACGTAACAAGTGATGGCAAACAGGTCGGACCGCGCCCCACCAAGTCTGAATCAGTAGTTGGACCTCGAGTCCATGGAGGAAATGAGACGTGGGTTGGCG
AATTCCATCAAGGCCAGCAGGCATCTGACCTGCGCCAAAGGCCGGATATAAAACTGCAGCCGTGTCCTGTCACACCATCACCGAAGACGTTCTTGGCAAA
CGGGAGGCGTCCATATA
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1026 bp341 aa1131138+No
ORF function : Transposase
Chemistry : DEDD

ORF sequence :

MSLSQTIVGIDIAKSVFQIHEVDKETGEVTSRQIKRARLLQHFINREPCFIGMEACGGAQHWARQFVAMGHTVKLLPAQSVRPFAGGNKNDVADARAIWI
AVQQPGIKAVAIKTEAQQAVLALHRMRQQLVKFRTAQINALRGLLAEYGEVMPLGRDAVAKALPSVFARLVDRLPGVLIESLREQYTRIAQLDKEVSNIE
RRLREWHRDDESCRRITAIPGVGLLTATATVAAMGDPGAFSSGREFAAWLGLVPRQTGTGGRVKLLGISKRGDRYLRTLLIHGARSVLMTSKTPPAWAAN
LATRRPLNVAVVALANKMARTLWALLAHQRVFQPEYVSRPA

 

Blast result :
Comments
ISPa49 is 80% aa similar to IS884.

Insertion site determined by comparison with PAGI-2 island (AF440523). DSM1128 is one of 7 draft genomes comprising a comparative genomics project on PA7-like P. aeruginosa.
References
1] Déraspe, M. and Roy,P.H. (2013) Direct submission