ISHhu3

  • Family IS200/IS605
  • Group IS605
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
LN831303 ND Halobacterium hubeiense
Halobacterium hubeiense plasmid pSTJ001
DNA section
IS Length : 1686 bp

Ends


Left end : ATCCTCCCACCCCTTCAGGGGTGGGATGAAGCCGACAACTGAGAATCTGTCTACGCTCGTAGGCACGGTTGCGGTTGGATACCTGCATAACATCTTTAGG II struct. : Yes
Right end : TCATCGTCGACCGTGACGACGAACCTGCGAACCTCTCCGTTTCCGTGGGTTCAACCCCCAGTGGAGGAACCCCACGGCGTTAGCTGTGGGAGGATGTCAG II struct. : Yes

Insertion site


Left flankLE cleavage siteRight flankRE cleavage site
TACTCCTGAGTCTTGACGCTGGTCCGGCATCAG

DNA sequence

ATCCTCCCACCCCTTCAGGGGTGGGATGAAGCCGACAACTGAGAATCTGTCTACGCTCGTAGGCACGGTTGCGGTTGGATACCTGCATAACATCTTTAGG
TGAATAGTTTCTATATACTGACGATGCCTCGTGGGTTCGACAGGGAACGTACCAACATCCACAAACTCCAGTACCACTTCATCTGGTGTCCGAAGTACCG
CAAATCGGTACTTGAGGGCGAGGTACGTGACCGTCTCGAAGAACTCATCGAGGAGAAAGCCGACGAACTCGGCCTCGAAATCTTGGAGTTGGCGATTCGC
CCCGACCACGTACACTTGTTCATCACGGGCGACCCGACACTCGCCCCGAACAAAATAATGCAACAGGTCAAGGGCTACTCCTCGCGCCACCTCCGTGACG
AGTTCGACTTCGGCCTCCCGTCGCTGTGGACGCGCTCGTACTTCGTCTCAAGCGCGGGCGACGTATCCAGCGAAGTCATCAAGGAGTACATCGACGCGCA
AGCAGGTGAGTAGTATGCAACGGAACGTCTCAACCACGGTGCGGGTCAAACTCCACTCGCTGACCAACAGGAAAGCCGACCTGCTCGCCCGTGAGTATGA
GGCGTTCCAGACCGAAGTTCACGGCGGAGACGCCGACCTCTACTCCGCGACCGACCAACAGGCGTCGAAGGTGCAACGGCAGAAAGACCCTAATCCCGAC
ACCGAACAGCCTGTCGTTCTCCGTAACGACGTATTCGACGTGACCTACGACGAAGATACCGTCCTCTCCTCGTGGTGGGTGAAAGTTCCCGTCTACGACC
CCGAGCGTGGACGGGGCAACTCCATCTGGTGCCCCGCCCACGTCCCACAGAAAGACGAACAACTCGTCTGTGAGGGTGATATTCGGGACAGTGAACTGGT
GCGCCGTGACGGTGAGTGGTACGTACATCTCGTCGTGAAGCGGTCTGTGACCGTCCAAGACGAGTACGACGACGTGCTGGCTATCGACATGGGCGCACGG
TGGGTCGCCACCTGCACGTTCCTCTCCGACCGAAAGACCACATTCTACGGCGAGGAAGTGCGCCGTATCCGCGAACACTACAAGCAACTGCGGAAGTTCA
TCGGGAAAGCGAAACCCCGACAGGGACAACAGGTGGTTGAGCGCATCGGTGACGCTGAGACACGGAAGGTGGACGACCGACTCCACAAGATTGCCCGACA
AATCGTAGAGAATGCCGAGGAACGGAATGCGGTTATCGTCGTGGGCGACCTCGGCAGGATTCGTAAAGACAACGACAAGGGGCGGTACATCAACGACAAG
ACCCACAAGATGCCGTTCGCCCGCCTGCTGAACTACATTGAGTACAAGGCCCACGACGCAGGCATCGAGGTGCAGTTGGTCGAAGAATACGACACGTCGA
AGACATGCAATCGGTGTGCCTGCGAGGGTGTTCGGGCAACACAGGGACGCTTTGAGTGTCCTGAGTGTGGGCTGGACGACAACGCAGACAAGAACGGTGC
GCTGAACATCGGCAAACGAGCCTTGGGCAAGTTCTCGAAACCGCTGTCTGAGGCGGGGGCTGTACTGGCACAGCCCGAAACGCAGGTCATCGTCGACCGT
GACGACGAACCTGCGAACCTCTCCGTTTCCGTGGGTTCAACCCCCAGTGGAGGAACCCCACGGCGTTAGCTGTGGGAGGATGTCAG
Protein section
ORF number : 2

 

ORF 1
LengthBeginEndStrandFusion ORF
390 bp129 aa124513+No
ORF function : Transposase
Chemistry : Y1

ORF sequence :

MPRGFDRERTNIHKLQYHFIWCPKYRKSVLEGEVRDRLEELIEEKADELGLEILELAIRPDHVHLFITGDPTLAPNKIMQQVKGYSSRHLRDEFDFGLPS
LWTRSYFVSSAGDVSSEVIKEYIDAQAGE

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
1155 bp384 aa5151669+No
ORF function : Accessory Gene
AG : TnpB

ORF sequence :

MQRNVSTTVRVKLHSLTNRKADLLAREYEAFQTEVHGGDADLYSATDQQASKVQRQKDPNPDTEQPVVLRNDVFDVTYDEDTVLSSWWVKVPVYDPERGR
GNSIWCPAHVPQKDEQLVCEGDIRDSELVRRDGEWYVHLVVKRSVTVQDEYDDVLAIDMGARWVATCTFLSDRKTTFYGEEVRRIREHYKQLRKFIGKAK
PRQGQQVVERIGDAETRKVDDRLHKIARQIVENAEERNAVIVVGDLGRIRKDNDKGRYINDKTHKMPFARLLNYIEYKAHDAGIEVQLVEEYDTSKTCNR
CACEGVRATQGRFECPECGLDDNADKNGALNIGKRALGKFSKPLSEAGAVLAQPETQVIVDRDDEPANLSVSVGSTPSGGTPRR

 

Blast result :
Comments
ISHhu3 is 99% aa (ORFA : the transposase) and 96% aa (ORFB) similar to ISH22.
Comparing to ISH22, it seems that 14 nt are missing between the clivage site and the secondary structure in LE extremity.
References
1] F. Pfeiffer (2013) Direct submission
2] Jaakkola S.T., Pfeiffer F., Ravantti J.J., Guo Q., Liu Y., Chen X., Ma H., Yang C., Oksanen H.M., Bamford D.H. (2015) Environ Microbiol. doi: 10.1111/1462-2920.13130