ISHla17

  • Family IS200/IS605
  • Group IS605
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
CP001366 ND Halorubrum lacusprofundi
Halorubrum lacusprofundi ATCC 49239
DNA section
IS Length : 1885 bp

Ends


Left end : GGAGATTCAAGGAGAAAGCCTCGCCATTCGGGGCGGGGATGAAGCCGACCAACAGCATTCAACCGCCAACGATGGCATAGACGGGGTTCCAACGCAATCT II struct. : Yes
Right end : TCCCAAAGAAGTGCGCACGAACCCGCAAGTTGCCTCCGTGGGTCGGTAGCCGAACCCCTATCGGAGGAATCCTCGCGCTTCAGCGCGGGGAGGATGTCAA II struct. : Yes

Insertion site


Left flankLE cleavage siteRight flankRE cleavage site
ACAGACCTGCGAGTTACACTCGGAATGAGTCAA

DNA sequence

GGAGATTCAAGGAGAAAGCCTCGCCATTCGGGGCGGGGATGAAGCCGACCAACAGCATTCAACCGCCAACGATGGCATAGACGGGGTTCCAACGCAATCT
TTAAGGCGTCTGACTACGATAGTATACATAGATGGTAAAGAGTACCCGTCACGCGAAATACGAGCTCTATTACCACATAGTATTCGTGCCGAAATTGGGT
GGGAGCGAAGGTTCCGCTGACCTCGCGGAACAGGGTTCCGCTCAGCATCGGCGTTCGCACCTGACGGGGAAGACGAAGGAACGTCTCGAAACCATCTTCG
CGGAAATCTGTGAGGATAAGGACCTCGAACTGGTCGAGTCCGAGGTCATGCTCAACCACGTACACCTGTTCATTGGGAGTCCGCCCAAGAACGCCCCATC
ACTCATTGTCAACTGGGTCAAGGGCATCTCGGCGCGGAAGTACAACCAACGCTACGACGACCGCGTGAAGTGGACTCGCTCGTACTATGTCGGTACGGCG
GGAAGTGCCTCGAAGGACGCTATCGAACGCTACATTGCTGAACAGGAAGGTGGCGACGAATGAAGCGCGTCAACACCTTCGAGATCGTGCCACAGACTGA
GAACGACAAAGGGTGCCTCCTACGGTTACTCGACGCCTCCGCTTCCCTGTGGAACGAACTGACCTACGAGCGCCGCCAGAACTACTTCGGTGACGGCGAC
GTGTGGGACACCTCCGAATACCGTGGACAGTACAACGGCGTCATCGGAAGCGCGACCGTCCAACAGGTCACGCGCAAAAACTCGGAAGCGTGGCGGTCGT
TCTTCGCCCTTAAAGAGAAAGGCGAGAACGCTAACCCCCCGTCTTACTGGGGCAACGAGGAGGAGGGACGCGAACTCCGTACCTACATCCGAAACGACCA
GTACACGATTCAGTGGGGCAAGCGGTCGCGTCTCGAAATTCCTGTCGGGCAAGAGTTAAAAGACGAATACGGACTTGGCTACCACGAACGATTCCGCCTC
GAAGTCCGAGGCAACCCGAAGTGGGATGGCAAACAGAGCCGTCTGGAACTTGAGTACGACGAAGTGAGTGACACGTTCAGGGCTTTCCAACCAGTCACCG
TGCCTGATTCTCGACTGGATTCACCACTGGCTTCTCACGAAGCCGCCCTCGACGTTGGCGCGAACAATCTCGTCGCCTGTTCCACGACTACTGGGAACCA
GTACATCTACGACGGTCGGGAGTTGTTCGGACGGTTCCGTGAGACGACCGACGAGATCGCTCGCCTACAGTCGAAGCTCCGTGAGGGACGCTACAGTTCC
AAACGGATTCGACGGCTGTACCGACAGCGGACGAAACGCCGTGACCACGCACAGAACGCGCTGGTGCGCGACCTCGTTGAACGGCTGTACGATGAGGGTT
TGGCGACGGTATACGTGGGCGACTTGACCGACGTGCTGGACACGCACTGGTCGGTCAGGGTGAACGAGAAGACGCACAACTTCTGGGCGTTCAAGAAGTT
CATCCACCGTCTCGCGTGCGTCTGTGAGGAGTACGGCATCTCTCTCGAAGCCGAGCCGGAAGCGTGGACGAGTCAGACGTGTCCTGAGTGTGGCGACCAC
GAGACGACGGTCCGTCACCGCGACACACTGACGTGTCCGTGTGGATTCGAGGGGCACGCCGACCTCACGGCGTCAGAGACGTTCCTTCGAGAAAACAGCG
ATACGGAAGTCAGGCCGATGGCACGGCCCGTGCAATTCGAGTGGGACGACCACGAATGGTCAGGGAAACCATACCCTCATGAAAGTCCCAAAGAAGTGCG
CACGAACCCGCAAGTTGCCTCCGTGGGTCGGTAGCCGAACCCCTATCGGAGGAATCCTCGCGCTTCAGCGCGGGGAGGATGTCAA
Protein section
ORF number : 2

 

ORF 1
LengthBeginEndStrandFusion ORF
432 bp143 aa132563+No
ORF function : Transposase
Chemistry : Y1

ORF sequence :

MVKSTRHAKYELYYHIVFVPKLGGSEGSADLAEQGSAQHRRSHLTGKTKERLETIFAEICEDKDLELVESEVMLNHVHLFIGSPPKNAPSLIVNWVKGIS
ARKYNQRYDDRVKWTRSYYVGTAGSASKDAIERYIAEQEGGDE

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
1275 bp424 aa5601834+No
ORF function : Accessory Gene
AG : TnpB

ORF sequence :

MKRVNTFEIVPQTENDKGCLLRLLDASASLWNELTYERRQNYFGDGDVWDTSEYRGQYNGVIGSATVQQVTRKNSEAWRSFFALKEKGENANPPSYWGNE
EEGRELRTYIRNDQYTIQWGKRSRLEIPVGQELKDEYGLGYHERFRLEVRGNPKWDGKQSRLELEYDEVSDTFRAFQPVTVPDSRLDSPLASHEAALDVG
ANNLVACSTTTGNQYIYDGRELFGRFRETTDEIARLQSKLREGRYSSKRIRRLYRQRTKRRDHAQNALVRDLVERLYDEGLATVYVGDLTDVLDTHWSVR
VNEKTHNFWAFKKFIHRLACVCEEYGISLEAEPEAWTSQTCPECGDHETTVRHRDTLTCPCGFEGHADLTASETFLRENSDTEVRPMARPVQFEWDDHEW
SGKPYPHESPKEVRTNPQVASVGR

 

Blast result :
Comments
ISHla17 is 95% (TnpA : the transposase) aa similar to ISHbo5 and 97% aa (TnpB) similar to ISHhu1.
References
1] F. Pfeiffer (2013) Direct submission
2] Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Dalin,E., Tice,H., Bruce,D., Goodwin,L., Pitluck,S., Sims,D., Brettin,T., Detter,J.C., Han,C., Larimer,F., Land,M., Hauser,L., Kyrpides,N., Ivanova,N., Anderson,I., DasSarma,S., Cavicchioli,R. and Richardson,P. (2009) Direct submission GenBank.