ISHaha8

  • Family IS200/IS605
  • Group IS1341
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
HE717023 ND Halobacillus halophilus
Halobacillus halophilus DSM 2266
DNA section
IS Length : 1367 bp

Ends


Left end : CATTTATCGGCAGAAGCCTCCCTCTTCAAGCACTGTGTCGAAGACCGGTGGTAAGGGGGAGATGAATGCCTTCGCCTTCAGGCGAAGGTTTTCGTTTTCT II struct. : Yes
Right end : CGACGGGGCTAGCCTAATCATTTGAACGAATCGTTAGGTTCGTGCTCTTAGGAATCCCCCAACTTCAAGGAGTGTCAGCGAGTAAGTGGGGGTAGTTCAA II struct. : Yes

Insertion site


Left flankLE cleavage siteRight flankRE cleavage site
GTCTGGGTCTTTTTAGTTTGAGACAAtcaa
TTTGATCCTCTTTTAGTGGACTAATCtcaa
TAAAAGCTCTTTTTAGTATATGTATAtcaa

DNA sequence

CATTTATCGGCAGAAGCCTCCCTCTTCAAGCACTGTGTCGAAGACCGGTGGTAAGGGGGAGATGAATGCCTTCGCCTTCAGGCGAAGGTTTTCGTTTTCT
ATTTTTACGGTCGTATGGTATTCTGAAATGAGAACGTAAGTTCCTGTATGGAGGTGGAAATGGTGACGCACAAAGCTTATAAATTTCGCATTTATCCTAG
TAAAGAACAAACAACGTTAATTGCTAAATCCATCGGATGTTCACGTTTTGTGTTTAATCATTTCCTCTCCGAGTGGAACAATGCTTACAAACGTTCTGGT
AAAGGTTTGTCTTATGCAAAATGCAATAAACAACTTACACAAATCAAACAAGATTTCCAATGGTTAAAAGAAGTTGATAGTACAGCTCTGCAAAATTCGT
TGAGGAATCTTGCAGATTCTTTCGATCGTTTTTTTAAGAAACTTAACAATAGACCGAAGTTCAAGTCTAAAAAGAATAGAAAGCAATCTTATACCGCTCA
ATACAACAAAGGCAATATCAGAATAGTCGGTAATAAAGTGAAGCTACCAAAGGTAGGCTGGGTGCTGTTTGCTAAGAGTCGTGAAGTAGAAGGGCGTATT
TTAAGCGCAACTGTTAGGCGGAATCCTTCAGGTAAACATTTTGTTTCTATTCTTGTTGATACAAAAGTCGAGAGACTTCCTAAAACCAACTCCTCTGTGG
GTATTGATCTCGGATTGAAAGACTTCGCTGTTCTCTCGAATGGCACCACCTATGAAAACCCACGATACCTACGTAAGACCGAAAAGAAACTAGCAAAAGC
TCAACGTATCATTTCCCGAAGGGAAAAGGGATCTTCGAATTGGCATAAGCAACGGATTAAAGTAGCCAGACTCCATGAAAAGATTACGAACTCTCGCAAA
GATTATCTGCATAAGATTTCTACCGAAATCATCAAAAACCACGATGTGATTGGGGTAGAAAATCTCCAAATTTCCAATATGCTCAAAAACCGAAAACTAT
CCAAATCGATTAGTGATGCGAGCTGGTCGATGTTCACTACTATGCTCGAATACAAAGCAGAATGGTACGGAAAACAATTGATACCCGTATCGAAAATTTT
TGCGAGTTCGCAACTGTGTTCCTATTGTGGATACCAAAACGGTGAGGTGAAGAATCTCGCTGTTCGAACGTGGGATTGCCCGAAGTGTGGCAGCCACCAC
AACCGCGATCTAAATGCGAGCTTCAATATATTGAAGGAGATTCAAAGGATCCTTCCAACCGTCGGTGCGACGGGGCTAGCCTAATCATTTGAACGAATCG
TTAGGTTCGTGCTCTTAGGAATCCCCCAACTTCAAGGAGTGTCAGCGAGTAAGTGGGGGTAGTTCAA
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1125 bp374 aa1601284+No
ORF function : Accessory Gene
AG : TnpB

ORF sequence :

MVTHKAYKFRIYPSKEQTTLIAKSIGCSRFVFNHFLSEWNNAYKRSGKGLSYAKCNKQLTQIKQDFQWLKEVDSTALQNSLRNLADSFDRFFKKLNNRPK
FKSKKNRKQSYTAQYNKGNIRIVGNKVKLPKVGWVLFAKSREVEGRILSATVRRNPSGKHFVSILVDTKVERLPKTNSSVGIDLGLKDFAVLSNGTTYEN
PRYLRKTEKKLAKAQRIISRREKGSSNWHKQRIKVARLHEKITNSRKDYLHKISTEIIKNHDVIGVENLQISNMLKNRKLSKSISDASWSMFTTMLEYKA
EWYGKQLIPVSKIFASSQLCSYCGYQNGEVKNLAVRTWDCPKCGSHHNRDLNASFNILKEIQRILPTVGATGLA

 

Blast result :
Comments
ISHaha8 is 89% (TnpB) aa similar to ISHaha7.
References
1] Pfeiffer, F. (2012) Direct submission.
2] Saum S.H., Pfeiffer F., Palm P., Rampp M., Schuster S.C., Müller V., and Oesterhelt D. (2013) Environ. Microbiol. 15 (5), 1619-1633.