ISHti7

  • Family IS5
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
HF571521 ND Halorhabdus tiamatea
Halorhabdus tiamatea SARL4B plasmid pHTIA
DNA section
IS Length : 1063 bp

Ends


IR Length : 19/24

IRL : GAGCGTGTCATAGAAAGCCTCCCAAGGGAGGCCGCAGGGTTTGGAAACTG
IRR : GAGCGTGTCGTAGAATCCATCTCACAGCTTCTCACAGCCCGGGTTGTTTC

Insertion site


Left flankDirect repeatRight flankDR Length
TTAGTTGGATTATGTAGTTA0

DNA sequence

GAGCGTGTCATAGAAAGCCTCCCAAGGGAGGCCGCAGGGTTTGGAAACTGTGTCCAGCAGTACCAACGCCCTGCAAGACGTAGCTTCGGTAGACGACTTT
TTGAATGCAGCGGCTACCGAGACAGTACCGCTGTTCGAACACCTTGAGTTCGAGTTTCTTCTGGAGTACGACGTGTTCGCCCCCTCAAAGCGGGGGCGAA
CACGAGTGCATCAGCCACCAGATCTCTTCCGCGGCTTTCTCCACTGCTACTACGAAAACGTCTACGGCACACGCCCGGTGACGAGAGAGCTCAAGCACAA
CCTCGTCTGGTACTACTGTGGACTCGACAAACCGCCATCCAGAGACACGATTGATCGCTTTCTCACCGACCTCGAACACGTTATTGACGATATCTTTGAC
AGGCTTGTCAAGCAGGCCGCCGCCTGCGGCCTGCTCGACTCCACGTACTCCATCGATTCGACCCACATCGAAGCGATCCAGTACAACGACGCAGCATCGT
GGAACTACGACCCAACAGCCGAGGAGTACTACTACGGCTTCGGCTGTACAATCGTCTCAACCGGCGCAAAAATCCCGATAGCAGCGGAATTCACACAAGC
GAAACAAGCGGATCAGGAGACGGCGATGCGCGTCATACGTGACGCGCTCACCGTCGATACACCGATCTGGATGCTTGGAGACAGCGCCTATGATATCCTC
GATTGGCACGACCACCTGCTGGCCGCAGGGGTCGTGCCAATCGCGCCGTACAATCCGCGAAACACTGACGATCCGAAAGATATCGAGTACAGGGTCGAAG
ACCGCATTACCGAACACAGCGAGGACGTTCAGCTGAAACAATCCATCTTGGACGAGACGTACAACAAACGGACAGGAGTCGAACGAACCAACGACGCAGT
CAAGGACTGCGGCCTCGGGCACGTCCGCGCCCGAGGCCGCGTCCACGCACGAACAGAAGTGTTCCTTGCACTCTGCCTACGGCTCGCCGTTGCCATCACC
AACTACGAGCGAGGAAACAACCCGGGCTGTGAGAAGCTGTGAGATGGATTCTACGACACGCTC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
990 bp330 aa501039+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MSSSTNALQDVASVDDFLNAAATETVPLFEHLEFEFLLEYDVFAPSKRGRTRVHQPPDLFRGFLHCYYENVYGTRPVTRELKHNLVWYYCGLDKPPSRDT
IDRFLTDLEHVIDDIFDRLVKQAAACGLLDSTYSIDSTHIEAIQYNDAASWNYDPTAEEYYYGFGCTIVSTGAKIPIAAEFTQAKQADQETAMRVIRDAL
TVDTPIWMLGDSAYDILDWHDHLLAAGVVPIAPYNPRNTDDPKDIEYRVEDRITEHSEDVQLKQSILDETYNKRTGVERTNDAVKDCGLGHVRARGRVHA
RTEVFLALCLRLAVAITNYERGNNPGCEKL

 

Blast result :
Comments
ISHti7 is 95% aa similar to ISNpe19.
References
1] Pfeiffer F. (2015) Direct submission
2] Werner,J., Ferrer,M., Michel,G., Mann,A.J., Huang,S., Juarez,S., Ciordia,S., Albar,J.P., Alcaide,M., La Cono,V., Yakimov,M.M., Antunes,A., Taborda,M., da Costa,M.S., Hai,T., Glockner,F.O., Golyshina,O.V., Golyshin,P.N. and Teeling,H. (2014) Environ. Microbiol (in press)