ISHwa23

  • Family IS200/IS605
  • Group IS1341
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
AM180088 ND Haloquadratum walsbyi
Haloquadratum walsbyi DSM 16790
DNA section
IS Length : 1496 bp

Ends


Left end : GGAGAATCGAGGAGAAAGCCTCGCGCTTCAGCGCGGGAATGAATCCGACGAACTCTCCACAGTCCACCGCCTGATAACATGGCAGGATATTCCACGCTGT II struct. : Yes
Right end : TTTGCACCTGAAGAACGGGTTAGGTCGTAAACCACAATATCCCAACTCAGCGGTGCGGTGCCGTGGGAATCCTCGCGCTTCAGCGCGGGGAGGATGTCAA II struct. : Yes

Insertion site


Left flankLE cleavage siteRight flankRE cleavage site
AAGCCGGAAATTACTGCGCACAGCtcaa
GATCTCTTTTTTACTGACTAACAGtcaa

DNA sequence

GGAGAATCGAGGAGAAAGCCTCGCGCTTCAGCGCGGGAATGAATCCGACGAACTCTCCACAGTCCACCGCCTGATAACATGGCAGGATATTCCACGCTGT
GGCAATACCCATACCATTAATTACGAATACTGTCATAGAGTACCTATGGCAAAACAGGTTGTCACGCGCACCTATACTGCTTCCATTCGGAATCAGTCAC
GGGTGTCCGACGATCTTGATGCCCTTGGGTTCGCAGCCTCGAAACTCTGGAACGTCGGACGGTGGACGTGTAGTCGCATCTGGGGTGAAATCGGTCACAT
CCCGAACCACACCGAACTCACCGCGTACCTCAAAACCCACGAACGCTACGATGACCTGCATTCGCAGTCAAGTCAGCGAGTCCTTCAAGAACTCGCTGAA
GCGTTCAACGGTTGGTACGGCAAACGACGCAACGGAGACATGAGAGCGAACCCGCCCGGCTACCGCAAACATGGTGACGAACACCCACGCAGCACGGTGA
CGTTCAAAGCCGCTGGCTTCAAACTCGATACCCAGTATAACCGCGTCCGGCTCTCTCAAGGCGCAAACCTCAAGAACTATTGGTCGGACTTCATCCTCTG
TACATTCCACACTCGCCCCGACGTTGACCTCTCCACCGTAGAGACCGTCCAGCAAGTGAAAGCAGTGTGGACAGGCGACGAATGGGAACTACACTTCGTC
TGCAAAGTGGAGATTGAGGCATCTGAGTCGCCCGGCGAGAAGACCGTCGGTGTTGATCTCGGTATTAAAAATTTTGCCGCGCTCGCCTACGAGGACGGTC
ACAGCGAGCTGTACCCGCTCAATTGCTTGAAACAGGACGACTATTACTTCAGCAAACGGATTGCTCGGTGTGACGACTCGAACTCCGAGCAGGTCACCCG
GCTGAATCATAAGAAGTCGGCTCGTCGCACTCACTATTTCCATACGCTTTCGAAACACATTGTTGAACGGTGTGTTGAGGAAGGCGTTGGAACTATCGTG
GTCGGCAATCTCTCCGACATCCGTTTGGATGAGGAGACCAATGAGGCAAAAAACTGGGGTAGGCATGGAAACCTCGATCTCCACTCGTGGGCGTTTGACC
GGTTCAGGAAGCTGCTCACCTACAAATCAGAGACGGAAGACATCACGGTTGAGCAGGAGTCTGAGCGCGATACGTCGAAGTCGTGTTCGTGTTGTGGTCG
CAAGCGGGATGGGAACCGCGTTGAACGCGGGTTGTACGTCTGCGATACGTGCGGTACAGTGGCGAACGCTGACGTGAACGGGGCCGAGAATATCCGACAG
AAAGTATCTCTGAGTTCACCGAATCTGTCGGTGAATAGGAGTAACGGCTGGTTGGCACAGCCATCGACGTTCCTGTTCGACAAGGAGACTGGTGCGTTTG
CACCTGAAGAACGGGTTAGGTCGTAAACCACAATATCCCAACTCAGCGGTGCGGTGCCGTGGGAATCCTCGCGCTTCAGCGCGGGGAGGATGTCAA
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1281 bp426 aa1461426+No
ORF function : Accessory Gene
AG : TnpB

ORF sequence :

MAKQVVTRTYTASIRNQSRVSDDLDALGFAASKLWNVGRWTCSRIWGEIGHIPNHTELTAYLKTHERYDDLHSQSSQRVLQELAEAFNGWYGKRRNGDMR
ANPPGYRKHGDEHPRSTVTFKAAGFKLDTQYNRVRLSQGANLKNYWSDFILCTFHTRPDVDLSTVETVQQVKAVWTGDEWELHFVCKVEIEASESPGEKT
VGVDLGIKNFAALAYEDGHSELYPLNCLKQDDYYFSKRIARCDDSNSEQVTRLNHKKSARRTHYFHTLSKHIVERCVEEGVGTIVVGNLSDIRLDEETNE
AKNWGRHGNLDLHSWAFDRFRKLLTYKSETEDITVEQESERDTSKSCSCCGRKRDGNRVERGLYVCDTCGTVANADVNGAENIRQKVSLSSPNLSVNRSN
GWLAQPSTFLFDKETGAFAPEERVRS

 

Blast result :
Comments
ISHwa23 is 90% (TnpB) aa similar to ISHla18.
References
1] Dyall-Smith,M.L., Pfeiffer,F., Klee,K., Palm,P., Gross,K., Schuster,S.C., Rampp, M., and Oesterhelt,D. (2011) PLoS One 6: e20968
2] Bolhuis, H., Palm, P., Wende, A., Falb, M., Rampp, M.,Rodriguez-Valera, F., Pfeiffer, F., and Oesterhelt, D. (2006) BMC Genomics 7, 169