ISHgi1

  • Family IS200/IS605
  • Group IS605
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
AOLJ01000001 ND Haloferax gibbonsii
Haloferax gibbonsii ATCC 33959
DNA section
IS Length : 1870 bp

Ends


Left end : ACTGGTCTCAAGGGCGAGTTCCCTGCGTCACCGGACGCGGGGGGTGAAGCCCGACACCCTGCTTAATGTTCAGTCTGTTCGATGTACCGTTGAACCACTT II struct. : No
Right end : CGCCCATCCTCATCCCGCGAAATCGCTTCGCGTGGAGTGCTTACAACGTAGGCTGAGGGAACAACAAAAGCCACGGGCCACCGTGCCCGTGGTCGTTTAC II struct. : No

Insertion site


Left flankLE cleavage siteRight flankRE cleavage site
TTCTTCGGGGGATCTAAGTCTAGTGGGCT

DNA sequence

ACTGGTCTCAAGGGCGAGTTCCCTGCGTCACCGGACGCGGGGGGTGAAGCCCGACACCCTGCTTAATGTTCAGTCTGTTCGATGTACCGTTGAACCACTT
CTTCGGATACCGCTCCGGTAGTCCCGACGTAGTAGCCTACTTTCCAGAACCCACCACCCCAAAAATATGATTCTCGGATTGCAGGATGGCGTTCAATGAT
GTGCTTTCCAGAGTACGACTTGAATTGTCGAGCCACATCAGCCGGACTATGCTTGGGGTCAGTCTGGACGAACAAGTGTACGTGGTCATCCGCAATTTCG
AGGGCGAGTATCTCGTGTCCGAAGTGGTCGGCTGTCTCCGTGAACAACCCTGTCACCTCGTCTTTGACGAGTTCCAGTATGGGGTGTCGGTACTTCGGAC
ACCACACGAAGTGATACTTACACGAACTAATCGAATGTGCATGACTCCAGTACTCTTCCATCCGAATCCCTACGCTTATTATCATTTGATTCGATAGTCA
ATGTATGGGTATCGAACCAGTCACGAAGACCGCACGCACTCGACTCTGCATAGAGTCTGGTGAGCGGTCGTGGCTCAAAGATGCCCGCTTCACCGCACGA
GACATCGCCAACGACACACTCCGACTCAAGCAAGACGGCTACAACCGCACCGAGATTCAGAAGGAAGTTGACCGCGAGGACTTCCTTCGGAACAACAAGT
GCGCGGTCGTCGGGAAAGCCCTGCAAGCGTGGGACTCCTACAAAGAACTCCTCAACTGGTGGCACGACCAAGACGACACCAACGTCGGGAAACCATCGCT
ACCAGACACGGACAAGAACGGAGCCTATCCGCTCGTCATGGCGCACACCGAAGGCTACCGACTTACCTACAACGACGATGACGACCGCGTAGCGTTCCGT
GTGAGTCCGAAGCCGTACAAGAAGGTGAAAGGACACCTTCGAGGACGACCAGAAGACTTCAACCTCATCGAGTCAGCCTTGACTGAAGATGAGTGGTCGT
TGGGGCAGGCCGAGCTTCTGTACCGAGATGGCGTGTACTACCTACACGTCACGGTCAAAACAGAAGTTGAGGTGCCAGAACCCGAAGACGCGGACACACT
CGTCGGCGTCGATATTAACGAGCGCAACATCGCTCTCACCGCTCTTAACCGTGAGACGATGGAAACGCTCGGAACACTCGTGCTTGACTACGGTTCGGTG
AAAGCCGAACGCCAACGCTACCACACCATCACAAAACGCTGTCAAGAACACGGCCAACACTCCATCCACTACCAACTCGGGGAGAAAGAAGAACACTATA
CAGAGTGGGTTCTTCACCGAATGTCCCGAGTCGTGGTAGAATTCGCCCAACAGTTCCCGAACCCCGTTATGGTGTTCGAGGACTTGAGTGGAATTCGAGA
CGCCATCAAGTACGGCACGTACATGAATCGGCGTCTGCACAAACTCCCGTTCCACAAGTTCGAGCAACAGGTTCGTTACAAAGCGACGTGGAACCAGATT
CCGTGTGAGACGGTCGAGTCTCCGTACAACTCGAAGTCATGTTCGTGCTGTGGTCATCGGGGATACCGTCAAGGACGACGGTTCCGGTGTACAAATGATT
CGTGTGCGGTTCATCAAGACCATGCTGACCGGAACGCGAGTGTGAATGTGGCGTGGCGAGTGTGGGCGAAACACGCTGGCGTAGATGTTGAATCGGTTAA
TTACCGGACTCGCAAAACCCAACCAAGTGTTCGGAAGGTGAGCCTGTCTGGGTCGGGGCGCTCTGTAAACCGCCCATCCTCATCCCGCGAAATCGCTTCG
CGTGGAGTGCTTACAACGTAGGCTGAGGGAACAACAAAAGCCACGGGCCACCGTGCCCGTGGTCGTTTAC
Protein section
ORF number : 2

 

ORF 1
LengthBeginEndStrandFusion ORF
369 bp132 aa43163-No
ORF function : Transposase
Chemistry : Y1

ORF sequence :

MEEYWSHAHSISSCKYHFVWCPKYRHPILELVKDEVTGLFTETADHFGHEILALEIADDHVHLFVQTDPKHSPADVARQFKSYSGKHIIERHPAIRESYF
WGGGFWKVGYYVGTTGAVSEEVVQRYIEQTEH

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
1317 bp438 aa5051821+No
ORF function : Accessory Gene
AG : TnpB

ORF sequence :

MGIEPVTKTARTRLCIESGERSWLKDARFTARDIANDTLRLKQDGYNRTEIQKEVDREDFLRNNKCAVVGKALQAWDSYKELLNWWHDQDDTNVGKPSLP
DTDKNGAYPLVMAHTEGYRLTYNDDDDRVAFRVSPKPYKKVKGHLRGRPEDFNLIESALTEDEWSLGQAELLYRDGVYYLHVTVKTEVEVPEPEDADTLV
GVDINERNIALTALNRETMETLGTLVLDYGSVKAERQRYHTITKRCQEHGQHSIHYQLGEKEEHYTEWVLHRMSRVVVEFAQQFPNPVMVFEDLSGIRDA
IKYGTYMNRRLHKLPFHKFEQQVRYKATWNQIPCETVESPYNSKSCSCCGHRGYRQGRRFRCTNDSCAVHQDHADRNASVNVAWRVWAKHAGVDVESVNY
RTRKTQPSVRKVSLSGSGRSVNRPSSSREIASRGVLTT

 

Blast result :
Comments
ISHgi1 is 94% (TnpA : the transposase) aa similar to ISH34 and 83% (TnpB) aa similar to ISNph6.
References
1] Friedhelm Pfeiffer (2015) Direct submission GenBank
2] Becker,E.A., Seitzer,P., Tritt,A., Larsen,D., Yao,A., Wu,D., Darling,A., Eisen,J.A. and Facciotti,M.T. (2012) Direct submission GenBank.