ISHsi2

  • Family IS200/IS605
  • Group IS605
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
AOLR01000028 ND Haloarcula sinaiiensis
Haloarcula sinaiiensis ATCC 33800
DNA section
IS Length : 1833 bp

Ends


Left end : GCCCCCTCCCTCAAGGAGCACCGCAGTCCGCGCAAGCGGACAAGGAGCGCAGTAGGGAGGGGATACAGCGCCGTCATCGTCTTCCATACACTGTTCTATT II struct. : No
Right end : TTCCTGTGGGAACCACCCCGGTTCCTGCAAAGCGCGTCTTGGAAGCAGGAAGCCCCACCCTCAGCGAGCGCGTCAGCGCGAGCAGGGTGGGGTAGTTCAC II struct. : No

Insertion site


Left flankLE cleavage siteRight flankRE cleavage site
GCCGTCGCCGCGCTAGCTGATAGCAGGCGCTAACACAGGGTTTGA

DNA sequence

GCCCCCTCCCTCAAGGAGCACCGCAGTCCGCGCAAGCGGACAAGGAGCGCAGTAGGGAGGGGATACAGCGCCGTCATCGTCTTCCATACACTGTTCTATT
CCCGGCCCACAGGCCCACGCAGTCGCACCTTCTTTTTATTAGGCTCTTCAAATATTGACCGAACCCAATGGAGTACGACCTCGATACGGGAGCGCACTCG
GTATATTCACTCCACTACCACCTGATACTCACCACCAAGTATCGGCGTGGTGTGCTCACCGAGGAGCGAACCCAATTCATTCGCGGGGTCATTGAGGGGT
TCGCGGACAAGTATGGTGTCACACTGACCAATCTCGACGGCGAAGACGACCATGTTCACATCCTGTTCCGAGCTGAGCCAACTACAGACCTCGTGAAGTT
CATCAACACCGTCAAAGGTGCAACTGCTCGACGCATCCGTAACGAGTACGAAGATGATCTCAAAACCGACCTGTGGGGCAACTCCTTCTGGAACGACTCG
TACTGTCTCATCTCAACAGGACAAGTCTCACTGGATGTGTTGAAAGAGTACGTCGAAGACCAACGAGCATGAACTACAACTACAGGTATCGCCTCACGCC
GACTGAAAGCCAGCGTGAGATGCTGGACTACCACCGCGATACCTGTCGCCAACTCTACAACCACGCCCTGTACCGCTTCAACCAGATTCCCGAAGACAAG
GGCACCGTCAAACAGCGTGTCCGCACAATCCGTGACGAGCTTCCCAACCTCAAAGATTGGTGGGACGCACTTACCGACATCTACTCCAAAGTGCTTCAGC
CCACAGTCATGCGGATTGCCAAAAACATCAACGCACTCGGGAAGCTCAAAAAACAGGGCTACAACGTCGGTGAACTCCGGTGGAAGTCACCACGCGAGTT
TCGCAGTTTCACCTACAACCAGTCTGGCTTCGAACTCGACAAGAAGGGTGGTCAGATCGTGTTGTCGCTGTCGAAACTCGCCGATATTCCTATCAAATTT
CACCGACCGCTGCCTGAAGACGCCACAGTCAAAGAAGTCACGCTCAAAAAAGAGAAAACCGGCGAGTGGTTCGCCATCTTCGGCATTGAGATGGATACAG
AACCGCCAGCCAAGCCACCGCTGGCGAATATTGACACTGACGAGATGGTCGGTATCGACGTGGGGATTCTGAAGTATGCCCACGACACAGACGGCACAGC
GGTCGAATCACTCGACCTCTCGGAAGAACGCGACAGGCTCGAACGAGAGCAACGGACGTTCTCGCGCAAAGCATACGAGTCCAACAACTGGGAGAAACAA
CGTCGGCGTGTCGCTGCGTGTCATTTTGACATCAAGCGAAAGCGACGTGATTTCCTGCACAAACTCTCGAACTACTATGCTCGGGAGTACGAACTGGTAG
CGGTCGAAGACCTCGACGTGAAAGAGATGCTGGAATCGCCGCGGAACAGCCGCAACACGGCGTCGGCGGCGTGGAACACCTTCACCGATATGCTCGAAAC
GAAGTGCGAGCGGGAAGGGACACACTTCGTGGAAGTTGAACCCGACGGCACCACCAAAGAGTGTGCTCAGTGTGGCGTCGAAACCGACAAACCGCTGTGG
GTGCGTAAACACTCCTGTCCTGCCTGTGGCTTCGAAGCGGACAGAGACGCAAACGCGGCGTGGAACATTCTTTCTCGCGGACTCACCGAACTAGGAGTGG
GTCACTCCGAAGGTACGCCTGTAGAGACTGCGCTTCCTGTGGGAACCACCCCGGTTCCTGCAAAGCGCGTCTTGGAAGCAGGAAGCCCCACCCTCAGCGA
GCGCGTCAGCGCGAGCAGGGTGGGGTAGTTCAC
Protein section
ORF number : 2

 

ORF 1
LengthBeginEndStrandFusion ORF
405 bp134 aa168572+No
ORF function : Transposase
Chemistry : Y1

ORF sequence :

MEYDLDTGAHSVYSLHYHLILTTKYRRGVLTEERTQFIRGVIEGFADKYGVTLTNLDGEDDHVHILFRAEPTTDLVKFINTVKGATARRIRNEYEDDLKT
DLWGNSFWNDSYCLISTGQVSLDVLKEYVEDQRA

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
1260 bp419 aa5691828+No
ORF function : Accessory Gene
AG : TnpB

ORF sequence :

MNYNYRYRLTPTESQREMLDYHRDTCRQLYNHALYRFNQIPEDKGTVKQRVRTIRDELPNLKDWWDALTDIYSKVLQPTVMRIAKNINALGKLKKQGYNV
GELRWKSPREFRSFTYNQSGFELDKKGGQIVLSLSKLADIPIKFHRPLPEDATVKEVTLKKEKTGEWFAIFGIEMDTEPPAKPPLANIDTDEMVGIDVGI
LKYAHDTDGTAVESLDLSEERDRLEREQRTFSRKAYESNNWEKQRRRVAACHFDIKRKRRDFLHKLSNYYAREYELVAVEDLDVKEMLESPRNSRNTASA
AWNTFTDMLETKCEREGTHFVEVEPDGTTKECAQCGVETDKPLWVRKHSCPACGFEADRDANAAWNILSRGLTELGVGHSEGTPVETALPVGTTPVPAKR
VLEAGSPTLSERVSASRVG

 

Blast result :
Comments
ISHsi2 is 95% (TnpA : the transposase) aa similar to ISHru2 and 93% (TnpB) aa similar to ISNph20.
References
1] Friedhelm Pfeiffer (2015) Direct subsmission.
2] Becker,E.A., Seitzer,P., Tritt,A., Larsen,D., Yao,A., Wu,D., Darling,A., Eisen,J.A. and Facciotti,M.T. (2012) Direct submission GenBank.