ISRel26

  • Family ISNCY
  • Group IS1202
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_007762 ND Rhizobium etli
Rhizobium etli CFN 42 plasmid p42a
DNA section
IS Length : 1500 bp

Ends


IR Length : 34/48

IRL : TGTAGCCGCAAAGTTAAAGTGTCCTGTTTCTGCAAAGTTAGAATGTCACT
IRR : TGTGGCGGGGAAGTTGGAATGTCCGCCGTTGTGCAAAGTAGAAATGTCCG

Insertion site


Left flankDirect repeatRight flankDR Length
TATGCGATATGTTATGACGTAATAA5

DNA sequence

TGTAGCCGCAAAGTTAAAGTGTCCTGTTTCTGCAAAGTTAGAATGTCACTCTCTTCCCGTTTTTGATGACGGTGGAGATTGCGGATGGGATTGATAGCGA
TGAGCGAGCGCCATCTGCAGCGGATCGAGATTTTGTCGAAGGTGGTCGACGGCCGCATGACGTTGGTGTCGGCGGCACATGTGCTTGATCTGAGCGAGCG
CCAGGTGCGTCGGCTGCTGGATCGGATCCGCACTGACGGCGCGGCATCGATAAGGCACAAGGCGATCGGTCGGCCATCGAACAACCGGATCAGCGACGGC
GTTCGCGATTATGCGATGACGTTGGTTGGCGAACGCTATGCGGATTTCGGTCCGACGCTGGCGGCCGAGAAGCTGGCCGAACGCGATGGATTGCGTGTGT
CGCGCGAGACGTTGCGCAGCTGGATGGTGGAGGCTGGCCTGTGGCTATCTGCCAAGCAGCGGCGGACGTTTCATCAGCCGCGGCTGCGGCGCGAGGCCTA
TGGCGAGCTGGTGCAGATCGACGGGTCGGAACACCGCTGGTTCGAGGATCGCGGGCCGCCGTGCTCGCTGCTGGTGTTTGTCGACGATGCGACTGGCAGA
TTGATGCAGTTGCGGTTTGTGCGCTCGGAAAGCGCCTTCAGCTATTTCGAGGCACTGGCGCTATACCTCAGGCGTCACGGCGCGCCTGTGGCCTTCTACT
CCGACAAGCATTCGGTATTCCGGGTGGCGAAGAAGGACGCCAAGGGTGGCCAGGGGATGACCCAGTTCGGGCGGGCGCTTTGCGAGCTAAACATCGAGAT
TCTTTGCGCAAATTCGAGCCAGGCCAAAGGTCGCGTCGAGCGCATGAACCGGACGCTGCAGGATCGGCTGGTCAAGGAATTACGGCTGGCGGGAATCTGC
GACATGGAGACTGGCAATGCGTTTTTGCCTGGCTTCATGGAGCACTACAATGCGCGGTTTGCGATCATCCCTGCCCGGTCCGAGGATTTGCACCGGCCGC
TGAATCTGGCCCCGGGTCGGTTAACTGAGGTCCTTTGCAAGCGCGAGCAGCGTTACGTCGGGGCGCAGTTGACGTTTTCGTTTGAACGCAAGCGGATCAT
GCTGGAGGAGACCGAGGTGACGCGCGGTCTGGTGGGCCGCTATGTCGAGACCTATGCCTATGCTGACGGCCGCCTGGATGTGCGCTGGAAGGGACATTCC
CTGCCCTACACGGTGTTCGACAAGGACCAGCGGGTGACGCATGCGGCAATTACCGAGAACAAGCGGCTCGGTGATGTTCTGGCCTATATCAAGGAGCGTC
AGGACCAGCAGGAAAAGCCGGTCGTGAAGAGCAACAGCGACAAAAATGGCTATAAGCCGAGAGGTCGCAAGCCCGGAAGGCGCACGGACTACATGAATGA
TCCGGCGGTGATTGCGCGGCGAGAGAAAGCGCTGTTGAGGCAGCAGGCTGCCGAGTGAACCGTCGATCGGATAGTCTCAAAGCTCTAAAGCCGAAGGGGT
GTCTCTCACCCGCCCCGATCTGCTCTTGCAACCGGTATCAGCCGCTCAGATCGGGGCTGATCGGTGTGCCGCGTAGCAACCTCGCGGACATTTCTACTTT
GCACAACGGCGGACATTCCAACTTCCCCGCCACA
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1374 bp457 aa581431+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MGLIAMSERHLQRIEILSKVVDGRMTLVSAAHVLDLSERQVRRLLDRIRTDGAASIRHKAIGRPSNNRISDGVRDYAMTLVGERYADFGPTLAAEKLAER
DGLRVSRETLRSWMVEAGLWLSAKQRRTFHQPRLRREAYGELVQIDGSEHRWFEDRGPPCSLLVFVDDATGRLMQLRFVRSESAFSYFEALALYLRRHGA
PVAFYSDKHSVFRVAKKDAKGGQGMTQFGRALCELNIEILCANSSQAKGRVERMNRTLQDRLVKELRLAGICDMETGNAFLPGFMEHYNARFAIIPARSE
DLHRPLNLAPGRLTEVLCKREQRYVGAQLTFSFERKRIMLEETEVTRGLVGRYVETYAYADGRLDVRWKGHSLPYTVFDKDQRVTHAAITENKRLGDVLA
YIKERQDQQEKPVVKSNSDKNGYKPRGRKPGRRTDYMNDPAVIARREKALLRQQAAE

 

Blast result :
Comments
ISRel26 is 66% aa similar to ISMex6. A copy of ISRel9 is inserted in the genomic copy of ISRel26 at position 1484, the ISRel9 sequence was in silico deleted in this file.
References
1] Víctor González, Rosa I. Santamaría, Patricia Bustos, Ismael Hernández-González, Arturo Medrano-Soto, Gabriel Moreno-Hagelsieb, Sarath Chandra Janga, Miguel A. Ramírez, Verónica Jiménez-Jacinto, Julio Collado-Vides, Guillermo Dávila (2006) PNAS. 7;103(10):3834-9