ISRel12

  • Family IS481
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
AEYF01000045 ND Rhizobium sp.
Rhizobium etli bv. mimosae Mim1 plasmid pRetMIM1e
Rhizobium sp. CCGE 510 plasmid pRspCCGE510d
Rhizobium etli CFN42
Rhizobium etli bv. phaseoli IE4803 plasmid pRetIE4803b
DNA section
IS Length : 1002 bp

Ends


IR Length : 23

IRL : TGTTTAGTCCCGGCATTTGATGGTGCATTATTTTCCTTGGCATGGAGGGA
IRR : TGTTTAGTCCCGGCATTTGATGGATCGGATCGATGATGAAACGATCTGGC

Insertion site


Left flankDirect repeatRight flankDR Length
TTCTTCCGAACCTAGTCCAAGAAGTT6

DNA sequence

TGTTTAGTCCCGGCATTTGATGGTGCATTATTTTCCTTGGCATGGAGGGAAGCACTATGGGCCAGGTTCTACACGGGAGCGCCACGACGACAGAGGCAAT
CCGTCGAGCAATACAAAATAGTGAAGAGAGCCTGAGAACGCTTTCGAAGCGATACGGGATCAACCAGAAGACCGTAGCTAAATGGAAGAAGCGGACATCG
TTGGCCGACCTTCCGACAGGCCCGAAGGCCCCACACTCGACGACCCTTTCCCTCGAAGAAGAGGCCGTCATCGTCGCCTTCCGCCGGCATACATTGCTGC
CGCTCGATGATTGCCTCTACGCTCTTCAGCCGACCATCTCACATCTGACGCGATCGTCGTTGCACAGGTGTTTGCAGCGCCACGGCATTTCACGTCTGCT
GGAGGTCGGAGGCGACAAGGAACCGAAGAAGAAGTTTAAAAGTTATCCCATCGGCTATTTCCACATCGATATTGCCGAGGTGCAGACGGCCGAGGGCAAG
CTCTATCTCTTTGTAGCAATTGACCGAACATCCAAGTTCGCGTTCACAGAACTCTACACCAAAGCCGGCAAGATGAATGCCGCCCAGTTCTTGCGCAATC
TGATCGCGGCAGTGCCCTACACCATTCACACCGTTTTGACCGATAATGGCATTCAATTCACCAACCGAGCTTGTGATCGAAATGCCTTCCAGCACATCTT
CGACTGGGTCTGCGACGATCACAGCATCGAGCATCGCCTGACCAAGGTGAAGCACCCCTGGACCAACGGACAGGTCGAGCGGATGAACCGAACGATCAAG
GAAGCGACCGTCAAGCGCTTCCACTACGACGATCATGCGCAATTGAAAAAACATCTGGCCGACTTTATCGACGCCTACAATTTCGGGCGCCGGCTCAAGA
CGCTAAAGGGCCTTACGCCTTACGAGTTCATCTGCAAACAATGGACTTTGGAGCCAGATCGTTTCATCATCGATCCGATCCATCAAATGCCGGGACTAAA
CA
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
951 bp316 aa571007+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MGQVLHGSATTTEAIRRAIQNSEESLRTLSKRYGINQKTVAKWKKRTSLADLPTGPKAPHSTTLSLEEEAVIVAFRRHTLLPLDDCLYALQPTISHLTRS
SLHRCLQRHGISRLLEVGGDKEPKKKFKSYPIGYFHIDIAEVQTAEGKLYLFVAIDRTSKFAFTELYTKAGKMNAAQFLRNLIAAVPYTIHTVLTDNGIQ
FTNRACDRNAFQHIFDWVCDDHSIEHRLTKVKHPWTNGQVERMNRTIKEATVKRFHYDDHAQLKKHLADFIDAYNFGRRLKTLKGLTPYEFICKQWTLEP
DRFIIDPIHQMPGLNT

 

Blast result :
Comments
ISRel12 is 89% aa similar to ISNwi5. The STOP codon is in the direct repeat.
References
1] González V, Santamaría RI, Bustos P, Hernández-González I, Medrano-Soto A, Moreno-Hagelsieb G, Janga SC, Ramírez MA, Jiménez-Jacinto V, Collado-Vides J, Dávila G. (2006) PNAS. 7;103(10):3834-9