ISRel10

  • Family ISNCY
  • Group IS1202
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_004041 ND Rhizobium etli
Rhizobium etli CIAT 652 plasmid pB
Rhizobium etli CFN 42 plasmid p42d
DNA section
IS Length : 2528 bp

Ends


IR Length : 36/51

IRL : TGTAGAGGCTATTTAGTAATGCGACAGTTGGGCCAGTTAGAGATGCGACA
IRR : TGTCAAAGCCGAATAGGGCTGCGACGCTGTCGGCCAGTTAGAAACGCGAC

Insertion site


Left flankDirect repeatRight flankDR Length
TATGCTATTTGGTGTTGTAGCCGCA5

DNA sequence

TGTAGAGGCTATTTAGTAATGCGACAGTTGGGCCAGTTAGAGATGCGACAATCTCGCCTCTCGACGACTGGTCAATGCCAATGTCGGGAGCAAGGATGAC
GACCTTCAGCCTGGTCGAGACCATGAGCGGTCGGAGTCGTCATGTCCTTTATGATCACTATGTCGCAGAAAGAATTGCATCGGCTCGAACTCATCCAGAA
GATCCGTGACGAACGCCTGAGCGTTGTGCAGGCCGCCGAACGGCTCGACCTCAGTCGAAGTCAGGTCCATCGGCTGCTGCAGGCCTATGACCGGGATGGT
CCGGCCGGGCTTGTTTCCAAGAAGCGATCGCGACCGAGCAACCGGCGCCATAGCGAGGAGTTTCGCAATGCGGCGCTGAATCTGATCCGTGAACGCTATC
TGGATTTCGGTCCGACGCTGGCGCGTGAGAAGCTGATCGAGCTGCACCGGATCTCGGTCGCCAAGGAGACCCTGCGGCAATGGATGACCGAGGCCGGCAT
CTGGGTCTCGCGTCGGGAACGCAAGAAGCGGGTTTTCCAGCCACGCGGCCGACGTGATTGCTTTGGCGAACTGGTACAGATCGATGGCTCGCATCACTGG
TGGTTCGAGAACCGTGGGCCCAAATGCGGCCTGCTCGTCTATATCGACGACGCCACCGGCAAGCTGCTGCATCTACGGTTTGCCGGCTCGGAGAACACCT
TCGACTATCTGCACGCGACCAAGGCCTATCTGCAGCAATGGGGCAAACCGCTGGCCTTCTACAGTGACAAGCACGGCGTCTTTCGTTCGACCCATGCGTC
GGAGAAGGACCGGACGAGCGGCCTGACACAATTCGGCCGCGCGCTTTATGAGCTGAACATCGACATCATCTGTGCCAATACCCCGCAGGCCAAAGGCCGC
GTCGAACGTGCGAACCAGACACTGCAGGATCGGCTGGTCAAGGAAATGCGGCTGCGCGGCATCGACACGATCGAGGAAGCCAACGCCTATGCGCCTGAGT
TCATTGCGGATTTCAACGCGCGTTTTGGCAAACAGCCGCGTAATCCGAAGGACATGCACCGGCCGTTGGCCGACCACGAGAACCTCGATGGCGCCATGTG
CCGCAAGGAAGTTCGCACGCTGTCGCAGGCTTTGACGCTGCGCTATGACAAGGTGCTGTTCATCCTTGATCCGACAGATCTTTCCAGGTCCCTGGCGGGT
AAGAAGGTCGTCGTTTGCGACTATCCGGACGGGCGCCTCGAGATCATGCACGAGAGCTTTGCCCTGCCCTACCGAACCTTTGACACGTTACGCTCCGTGC
ATCGCGCCGAGGTCGTCGATAACAAGCGGTTGGACGACATGCTGTCTGTTGTCGCCGAGCTGCAGGCTGGGCGGGAGCAGCAGCGCAGCAAGGGCGGACC
ACGGCGAACTGGGCAGACGGACCATATGTTCGGCATTCGCGATGGCAGCACGGGGAACGGCTACCAGAAACGTGGACGCAAGCCGAGAACGGATTACATG
AACGATCCGGCGGTGATCGCACGGCGGGAGAAAGCGTTATTGAGGCAGCCGGCTGCGGAATAAAGGGCGTCAATGCACGCCGATATCGCTTTGCGTATCT
GACTCCAATTGCAGGCAGGCGGACCAAAGCGGCGTCTTGTGGAAGGCTCCGTCTTGAAGAAGCGTGAGCCCTTCTCGTGCCTCATAAAGCAGGCCCAGCC
AGCACAGGCGCCGCAGGACGCCATATTGGAGATCGGATTTGAGCTCCCAGGCTTCCAGGGTCATTTCGGTGGCGGACAGAGGTGCCGTGTCTGGATAGAG
GATCTTCACGACGTCCAAAGGCGTACAGCCTTCTCTCGCCTTGATATTGAGAAGATTGAGGAACATGCGCCACCAGCGTAGGCGCGCTTGCACCTCAGCT
TCCCGCTCGGTGGCATGGACATACGAGTAGAGATAGTCTGTGGCCACGAGATCGAAGAAGGCTTGCGGGTTCACCAGAAACTCCCGGCCGCGTCTGGTTG
GCAGCAGCACATCCTTTTTCCGGCGAAGAAGCTTCAGATGGCGGGTCGTGTCCCGCACGACCCAGAGCGGCGGCATGTCGCTTTCGTTCAGCACTTTGTT
CATGCTGTAAAGGTCTTCAGCTGTGAAGTCGGGCCACAGGAAGTTCACAGCGGCCCAATGTACGAATTTGCGGTTCATAGCACCGGTCGCGGTCAATCCT
ATGCCACCCTCACCGTCAGCATAGGCAACGGACAGAAGCATGCCGCGGAAGAGGTGACAGCGCGGCGACATCGACGTCACCCTGCAGCTTGATTTCCGGA
AGCATCGTGCAGCTTTGATCCCTACCCGCTCAATTCAGATAAAAGCGAGTATCAGCCGGCGACTGAACAATTGCTATTGAGAAAGCTAAAGCCGAAGAGG
TGTTCTTTCACCCGCCCCCGCTCCGCCCTTTCAACCCGGCCCAGCCGGTCGGATCGGGGGCTGATCATCGGTGCCAGTGTCGCGTTTCTAACTGGCCGAC
AGCGTCGCAGCCCTATTCGGCTTTGACA
Protein section
ORF number : 2

 

ORF 2
LengthBeginEndStrandFusion ORF
711 bp236 aa22801570-No
ORF function : Passenger Gene
Annotation : Hypothetical proteinDescription :

ORF sequence :

MTSMSPRCHLFRGMLLSVAYADGEGGIGLTATGAMNRKFVHWAAVNFLWPDFTAEDLYSMNKVLNESDMPPLWVVRDTTRHLKLLRRKKDVLLPTRRGRE
FLVNPQAFFDLVATDYLYSYVHATEREAEVQARLRWWRMFLNLLNIKAREGCTPLDVVKILYPDTAPLSATEMTLEAWELKSDLQYGVLRRLCWLGLLYE
AREGLTLLQDGAFHKTPLWSACLQLESDTQSDIGVH

 

Blast result :
ORF 1
LengthBeginEndStrandFusion ORF
1422 bp473 aa1421563+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MSFMITMSQKELHRLELIQKIRDERLSVVQAAERLDLSRSQVHRLLQAYDRDGPAGLVSKKRSRPSNRRHSEEFRNAALNLIRERYLDFGPTLAREKLIE
LHRISVAKETLRQWMTEAGIWVSRRERKKRVFQPRGRRDCFGELVQIDGSHHWWFENRGPKCGLLVYIDDATGKLLHLRFAGSENTFDYLHATKAYLQQW
GKPLAFYSDKHGVFRSTHASEKDRTSGLTQFGRALYELNIDIICANTPQAKGRVERANQTLQDRLVKEMRLRGIDTIEEANAYAPEFIADFNARFGKQPR
NPKDMHRPLADHENLDGAMCRKEVRTLSQALTLRYDKVLFILDPTDLSRSLAGKKVVVCDYPDGRLEIMHESFALPYRTFDTLRSVHRAEVVDNKRLDDM
LSVVAELQAGREQQRSKGGPRRTGQTDHMFGIRDGSTGNGYQKRGRKPRTDYMNDPAVIARREKALLRQPAAE

 

Blast result :
Comments
ISRel10 is 70% (ORFA : the transposase) aa similar to ISMex6. The second ORF is a passenger gene annotated as hypothetical protein.
References
1] Víctor González, Rosa I. Santamaría, Patricia Bustos, Ismael Hernández-González, Arturo Medrano-Soto, Gabriel Moreno-Hagelsieb, Sarath Chandra Janga, Miguel A. Ramírez, Verónica Jiménez-Jacinto, Julio Collado-Vides, Guillermo Dávila (2006) PNAS. 7;103(10):3834-9