ISRel7

  • Family IS110
  • Group IS1111
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_007761 ND Rhizobium etli
Rhizobium etli CFN 42
DNA section
IS Length : 1342 bp

Ends


IR Length : 13

IRL : gatgtggTGGACGGCCTCCGCACCCGGCATCGCAATGTGCCAAAGTGTGG
IRR : ----gtaTGGACGGCCTCCGTGGCAAGGGGCAGTTAGTGTTTCTGGCAGA

Insertion site


Left flankDirect repeatRight flankDR Length
ACGGTGACCTATGCCACTGA0

DNA sequence

GATGTGGTGGACGGCCTCCGCACCCGGCATCGCAATGTGCCAAAGTGTGGCTGTCGAAAGTCACATAAGGGAGAGCCGTCCATGGAGAAGATTACCACAA
TTGGTCTGGATATCGCCAAGCATGTATTTCAGGTTCACGGGATCAATGGTGCCGGCGCGACGGTGAACCGCCGCAAGCTGCGCCGCGACGATGTCGTTGG
ATTCTTCAAGGCATTGCCGCCATGCCTGATCGGAATCGAGGCATGCGCGACTGGACACCACTGGGCTCGGGTTCTTATGGCGCTGGGTCACGAGGTTCGG
CTGATGCCGGCGTCTTACGTCAAGCCATATGTGAAGCGGCAGAAGAATGACGCGACGGATGCCGAGGCGATTTGCGAGGCGGTGACGCGGCCGACGATGC
GCTTCGTTCCAGTGAAAAGCGAGGAGCAACAGGGTGTGCTGATGCGGCATCGGGTCCGCGAGCTTTTGATCCGGCAGCGGACAATGCTGGTGAACGCCTT
GCGCGGCCACTTGGCGGAGTTCGGCATCGTAACGCGACAGGGCATTGCCGGCGTCGGAATGCTGATCGCGTTGGTCGACGACGATGATCACGATCTAATC
CCGCCGCTTGCGCGGTCCGCGCTTCTTCCCCTAATCGGGCAGTTGCGGGAGGTGCACGAGAAGGTCAGAGAGCTGGATCGCCAAATTCATGCTTGGCATC
GCTCGAACGAACTGAGCCGCCGCCTTGAGACGATCCCTGGAATTGGCCCGATCACTGCCAGCGCAATTGCCGCGACGGTGACCGACGCGTCGTTCTTCAA
ATCCGGCCGACAATTGGCGGCATGGATAGGCCTGGTGCCGCGGCAGAACTCATCGGGTGGCAAGGACCGCCTCGGAAGGATCAGCAAACAAGGCGATCCC
TATCTCCGCCGGCTTCTTGTTGTGGGCGCGCATGCGGTGCTTCGTTTCAGCGGCAAGGCTAAAGTTGCACCGACGCGTTGGGCCGCCGAACTTCTGCCGC
ACAACTTCGTCGCTGTTGCTTTGGCCAACAAGATGGTGCGGATCGTCTGGGCGTTGATGACGACGGGCAGGCGCTTTGAGGCGACCGCTGCCCTTTGAAT
GCTCACAGAGGATGCAGAAATTGGTGAGGTGCTGATGGCGTGATGGCGAACGGTCGAGCCGGGATCGGACAAACCCGATCAGTGGGTGCCGCTTGAAAGC
ATTGACCTGTCTGGGATCCGATCAGCGGACTACATCAGGGCCAGCGGCATGAACGCGCCGCAATCAAAGGCCGTATACATGCCTGCACCCGACCAATCTG
CCAGAAACACTAACTGCCCCTTGCCACGGAGGCCGTCCATAC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1017 bp338 aa821098+No
ORF function : Transposase
Chemistry : DEDD

ORF sequence :

MEKITTIGLDIAKHVFQVHGINGAGATVNRRKLRRDDVVGFFKALPPCLIGIEACATGHHWARVLMALGHEVRLMPASYVKPYVKRQKNDATDAEAICEA
VTRPTMRFVPVKSEEQQGVLMRHRVRELLIRQRTMLVNALRGHLAEFGIVTRQGIAGVGMLIALVDDDDHDLIPPLARSALLPLIGQLREVHEKVRELDR
QIHAWHRSNELSRRLETIPGIGPITASAIAATVTDASFFKSGRQLAAWIGLVPRQNSSGGKDRLGRISKQGDPYLRRLLVVGAHAVLRFSGKAKVAPTRW
AAELLPHNFVAVALANKMVRIVWALMTTGRRFEATAAL

 

Blast result :
Comments
ISRel7 is 72% aa similar to ISCc4.
References
1] Lozano LF (2010) Direct submission.

2] González V, Santamaría RI, Bustos P, Hernández-González I, Medrano-Soto A, Moreno-Hagelsieb G, Janga SC, Ramírez MA, Jiménez-Jacinto V, Collado-Vides J, Dávila G. (2006) PNAS. 7;103(10):3834-9

3]Gonzalez,V., Santamaria,R.I., Bustos,P., Hernandez-Gonzalez,I., Medrano-Soto,A., Moreno-Hagelsieb,G., Chandra-Janga,S., Ramirez-Romero,M.A., Collado-Vides,J. and Davila,G. (2005) Direct submission GenBank.