ISFw1

  • Family IS5
  • Group ISL2
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
ND Francisella sp.
Francisella sp. W12-1067
DNA section
IS Length : 952 bp

Ends


IR Length : 17

IRL : AGACCTCTTTCGAAACTATAATATAAAGTTTATACTGGGTTTCAGAGAAA
IRR : AGACCTCTTTCGAAACTCATTTATGTAACTCCAGGTTATAAATGCCAGCT

Insertion site


Left flankDirect repeatRight flankDR Length

DNA sequence

AGACCTCTTTCGAAACTATAATATAAAGTTTATACTGGGTTTCAGAGAAAGCTAATATTATGGTTTTGTATTGAAATACGCACAAGAGAAGTTTTTATCA
GAGGAACAATTCAGAAGATTAACAGGAGTCAAGCGAAGTACGTTTGAGAAGATGGTAAAAATCTTAGATGAAGCAGATAAGAAGAAAAAAGCAAAAGGAG
GTAGAAAGAACAAGCTTAACATAGAAAACCAGCTATTAATGGCCTTGGAATACATGAGGGAATATCGCACCTACTTTCACGTTAGTCAAAGTTATGGAAT
AAGTGAAAGTTCTTGCTATAAAGCGATTAAATGGATAGAAGAAACATTAATCAAGCATCCGGACTTCTCTTTGCCCGGAAGAAAAGCTTTGCTTAAAAGC
GATATGGACTATGAAGTTGTGCTCATAGACGCAACTGAAACACCATGCGAGCGCCCAAAAAAAGGGTAAAAAATAACCAGCGGATCAAGAATCGAAATAA
TAAGCAAAGGCATTTTTACTCTGGCAAGAAGAGAAGGCATACTTTAAAGGCTCAGGTTGTTGTTGATAAGAAAACTAAAGCAGTGATATGCACCGCATTT
TCAAACGGCAAGCGGCACGATTTTAGGTTGTTTAAGGAATCCAAAACCTATATCCATCCTGAAAAGAGAGTCATTACTGATACTGGATATCAAGGCATAC
AAAAGCTTCATAGCAAATCTGAGTTGCCCAAAAAGAAGAGTAAGAAAAATCTTTTAACGAAAGAAGATAAAAAGAAAAACCAAGAACTTGCGAGTCAAAG
GGTGTTGAATGAAAATGTCATTGGCATGATTAAACGATTTAAAATCGTATCTGATAAATATAAAAATAGACGAAAAAGATTTGGACTAAGATTCAATTTA
ATAGCTGGCATTTATAACCTGGAGTTACATAAATGAGTTTCGAAAGAGGTCT
Recoding section
  • Recoding by frameshift
  • Frame
  • Type
  • Experimentally demonstrated

Stimulators :

  • Shine-Dalgarno sequence :
  • Secondary structure :

Recoding motif :

Protein section
ORF number : 3

 

ORF 1
LengthBeginEndStrandFusion ORF
399 bp132 aa71469+No
ORF function : Transposase
Description : First part of the transposase

ORF sequence :

LKYAQEKFLSEEQFRRLTGVKRSTFEKMVKILDEADKKKKAKGGRKNKLNIENQLLMALEYMREYRTYFHVSQSYGISESSCYKAIKWIEETLIKHPDFS
LPGRKALLKSDMDYEVVLIDATETPCERPKKG

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
498 bp165 aa439936+No
ORF function : Transposase
Description : Second part of the transposase

ORF sequence :

NTMRAPKKRVKNNQRIKNRNNKQRHFYSGKKRRHTLKAQVVVDKKTKAVICTAFSNGKRHDFRLFKESKTYIHPEKRVITDTGYQGIQKLHSKSELPKKK
SKKNLLTKEDKKKNQELASQRVLNENVIGMIKRFKIVSDKYKNRRKRFGLRFNLIAGIYNLELHK

 

Blast result :
ORF 3
LengthBeginEndStrandFusion ORF
866 bp288 aa71936+Yes
ORF function : Transposase
Chemistry : DDE

ORF sequence :

LKYAQEKFLSEEQFRRLTGVKRSTFEKMVKILDEADKKKKAKGGRKNKLNIENQLLMALEYMREYRTYFHVSQSYGISESSCYKAIKWIEETLIKHPDFS
LPGRKALLKSDMDYEVVLIDATETPCERPKKRVKNNQRIKNRNNKQRHFYSGKKRRHTLKAQVVVDKKTKAVICTAFSNGKRHDFRLFKESKTYIHPEKR
VITDTGYQGIQKLHSKSELPKKKSKKNLLTKEDKKKNQELASQRVLNENVIGMIKRFKIVSDKYKNRRKRFGLRFNLIAGIYNLELHK

 

Blast result :
Comments
ISFw1 is 83% aa similar to ISOt6.
The third ORF is a putative ORFAB transposase reconstructed in silico by possible -1 frameshift.
References
1] Rydzewski K, Schulz T, Brzuszkiewicz E, Holland G, Lück C, Fleischer J, Grunow R, Heuner K.
BMC Microbiol. 2014 Jun 25;14(1):169.