ISHti12

  • Family IS701
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
HF571521 ND Halorhabdus tiamatea
Halorhabdus tiamatea plasmid pHTIA
DNA section
IS Length : 1277 bp

Ends


IR Length : 16

IRL : CTCAGCTTTGAACGTTGAAGTAGGATCGTGACGTAGGCAGTAGCGAACAC
IRR : CTCAGCTTTGAACGTTAGCGTCGGCTGTTGAGTGAACGAAAAGGTGATCG

Insertion site


Left flankDirect repeatRight flankDR Length
GGAAGCCAGGTTACAAAGCGCTCAAAC7
CGGTGTTAACTGTGAATTCAGCCAGT6

DNA sequence

CTCAGCTTTGAACGTTGAAGTAGGATCGTGACGTAGGCAGTAGCGAACACGGATGATGCCGATTACGGACTTCTTGTCGTGCACGCGTGTATTCGACGAG
TTCGAGTCGCTGTCACCCGCACAACGTCAGCACGCGAAAACCTACGCCACAGGTCTTGTTGCAGCCAGCAACAAGACCGTGGCAGGCATCGCACGCGAAG
TCCTTCCAGCTGGAGACAAACGCGCTCTCAACAAGTTCCTCACCGAGTACAACTGGGACGAACAGCAATTCAACCACGAACGCCTCGAAGAACTCCAAAA
ACACGGTGAAACACGCTGGTCAAAAAATGGCTACATCATCCTCGACGACACGATCACCGAGAAAGCCGGGGACGAAGTCCCCGGCGTCGGCCACTTCTAC
GATCACGCTGAAGGTGACACTGTCTGGGGCCAAGACATCATCTACGCCTTCTACGCTGACGACAAAACCGCCTACCCACTCACCTTCCGCCTCTACGAAA
AACAGGACGAAAACGACCAAAATCACGACACTAAGTACGATCTCGCCCGTGAGATCGTCACCGAACTCGAAGACGAGGTAGGTGTCCCGGCGGACACCTA
CCTCTTCGACTCGTGGTTCGCTCACGATTCTACCCTCGTCGAACACATCGAATCCTACGGCAACGACTGGATCGGCCCGCTCCGGAGCAACCGACAGGTA
ACCTACGCCGGCGAAGAGATCAGCGTCGATGCGCTGGCAGAGCGCATCGACACCGTCGAACGTAACGTTGAGGACGAGACCTACCACATCTGGACGAAGA
AGCTTCCCGTCTCCCAACTGGGAGACGTGAAGCTGGTCATCGCCGAGAAAGAAACTGACGAAGACGAAGAGAACCCGGTCAAATACCTCGCCACGAACAA
GATCGACGCACCGACCGAGCACGTGATTCGCTCTTACGGAATGCGGTGGCGCATCGAGACGTTCTTCGAGGACTCGAAGCAGGATCTCGGCTTGGGAGAC
TGCGAGATGCAGACTGACGAAGGTGCCAGTCGGCACTGGCACCTTCTGATGGCTGCCTACAGTCTCGTTCGTCTTGATCCCGATTCGAGAGCCTTGGGGA
CGGTTCGCTCGAAAGCGTCATCGCTTCGAGCGAACCTCGAACATTCCCTGAAGGAAGCCGTTTACAACCTGCTCTCGTGGGTTCGAGACAACGATGATCG
TGGCGTCGATGACCTTATGAAAGAGATCGATCACCTTTTCGTTCACTCAACAGCCGACGCTAACGTTCAAAGCTGAG
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1224 bp407 aa531276+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MMPITDFLSCTRVFDEFESLSPAQRQHAKTYATGLVAASNKTVAGIAREVLPAGDKRALNKFLTEYNWDEQQFNHERLEELQKHGETRWSKNGYIILDDT
ITEKAGDEVPGVGHFYDHAEGDTVWGQDIIYAFYADDKTAYPLTFRLYEKQDENDQNHDTKYDLAREIVTELEDEVGVPADTYLFDSWFAHDSTLVEHIE
SYGNDWIGPLRSNRQVTYAGEEISVDALAERIDTVERNVEDETYHIWTKKLPVSQLGDVKLVIAEKETDEDEENPVKYLATNKIDAPTEHVIRSYGMRWR
IETFFEDSKQDLGLGDCEMQTDEGASRHWHLLMAAYSLVRLDPDSRALGTVRSKASSLRANLEHSLKEAVYNLLSWVRDNDDRGVDDLMKEIDHLFVHST
ADANVQS

 

Blast result :
Comments
ISHti12 is 97% aa similar to ISHala1.
IS_pep_1 is HTIA_p2866, starts in UniProt with GTG for Val-42.
References
1] Pfeiffer F. (2015) Direct submission
2] Werner J., Ferrer M., Michel G., Mann A.J., Huang S., Juarez S., Ciordia S., Albar J.P., Alcaide M., La Cono V., Yakimov M.M., Antunes A., Taborda M., da Costa M.S., Hai T., Glockner F.O., Golyshina O.V., Golyshin P.N. and Teeling H. (2014) Environ Microbiol. Aug;16(8):2525-37.