ISHarch20

  • Family IS200/IS605
  • Group IS1341
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
CP002988 ND Halophilic archaeon
Halophilic archaeon DL31
DNA section
IS Length : 1533 bp

Ends


Left end : AGAGATTCGAGGAGAATGCCTGACCCTTCAGGGTCAGGATGAATCCGACAATCAACCACACAAACCACAGTCGATAGCACGGCCTGATATTCCAATAGAT II struct. : Yes
Right end : TCCACTTCGTGGATTCCCGCGTTGACGAGAGCAAAGCTCTCGTTCGCACACCAGAAACCAAAGATTTCTGGGGACGTCTTTAGGCGCGGGAGGATGTCAA II struct. : Yes

Insertion site


Left flankLE cleavage siteRight flankRE cleavage site
AGCAGCGAACCGTTACTTCGCCAATTCGtcaa
GCGATACTGAAATTACTGTCTATAGCCGtcaa

DNA sequence

AGAGATTCGAGGAGAATGCCTGACCCTTCAGGGTCAGGATGAATCCGACAATCAACCACACAAACCACAGTCGATAGCACGGCCTGATATTCCAATAGAT
ATTTAAGGAACCAACTATAATTACAATTGTAATGGTCACGGTGAGTGTCACCACGAAGTTACACAATCCATCCCTCTTACGGCGGAAGGAGTGGCAACGC
GCTACCCGCCTCTACGGTGACACCAAGCGATTCTGTATCGACGGATGGGAGAACGACGACTTCGGAAAGTCCGTGACCACAGCCAGTATTGACAACGACC
TCTACTCGGCCATTCAGAACCAAGCCATTCGAGAGGCGAAATCCGACCACAACAAGGACGGAGAGGTTCGCTACCGAGAGAGTCAACCGTTCGCCATTAA
CAACCAGAATTGGAAGATCGACACGACCGAGAACGGAACGGTTGTCGTCGGTTTCCCGTGCGTCTCCCAATGGTGGTACACCCCGATAGAAGTGTACGAT
GACATTGATGACCCCGTACAGCGACTGGTCGAGGGGGACGCCGACAAGACCCGCCTACAGGTCTACCGTCGTGGTGACGACTGGTTCTGTACGTTCAACA
TCAAATACGACATCGACACATCTGGTGAGACGCCTATCGGTGTTGATATTGGCGAACGACACATCCTCGCTGTGACGGCCTACGGCGAGGGCGAGTCCAT
GCTGGTGTCGGGTGGTGAGGCGAAATATGTTCGACGCAAATATCGTTCCCTACGCGATTCGCTATCGGAAGCGGGTGCGCTTCGCGCACGCAACCGTGTG
GGTGACAAAGAACAGCGTCGGATTAAGGACTTAAACCACAAACTCTCCCGTCGTCTCATCACGTTCGCGGAACAGTTCGGGAATCCCGTCATTCGGATGG
AGGACCTCGAAGGCATTCGTGAGAACAGTTCGTGGTCGGGCGTTCACTCGTGGCATTTCCACCAGCTCCAACAGTTCATCACGTACAAAGCCGAACGCGC
TGGCATCCGTGTCGAGAAAGTGGATGCATACCATACCAGTCAGGAGTGTTCGGCGTGTGGTTCGATGGGAGCCCGTGATGGCGACCACTTTTCGTGTTCG
GAGTGCAACCGTGGACGCCACGCCGACCTGAACGCTTCGGAGAACATCGCACAACGGGAGGGAGAACCATGCACGGCCTAACATCCTCGAAAACGCGGCG
CGTTTTCGGGCGCACGGAAATCTGTGATTTCCGTAGCCTTCTGTGAGGCGAACCGTGCTACCTCGCGGGTTAAAGAACCCGTCGTCGTTGACGCCCGCTG
TATGCGGGGAGGAAGGCCCCATTGACAGGGCTGTACGCGCTGGAAAGCACACCGTTGGTCACAACTCGGTGGCGACCTTCGACGTTCCACGCGAAAGCGT
ACTTGAGAACCGAGGAAACGCGCAACCGGAATATCCACTTCGTGGATTCCCGCGTTGACGAGAGCAAAGCTCTCGTTCGCACACCAGAAACCAAAGATTT
CTGGGGACGTCTTTAGGCGCGGGAGGATGTCAA
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
50 bp349 aa132181+No
ORF function : Accessory Gene
AG : TnpB

ORF sequence :

MVTVSVTTKLHNPSLLRRKEWQRATRLYGDTKRFCIDGWENDDFGKSVTTASIDNDLYSAIQNQAIREAKSDHNKDGEVRYRESQPFAINNQNWKIDTTE
NGTVVVGFPCVSQWWYTPIEVYDDIDDPVQRLVEGDADKTRLQVYRRGDDWFCTFNIKYDIDTSGETPIGVDIGERHILAVTAYGEGESMLVSGGEAKYV
RRKYRSLRDSLSEAGALRARNRVGDKEQRRIKDLNHKLSRRLITFAEQFGNPVIRMEDLEGIRENSSWSGVHSWHFHQLQQFITYKAERAGIRVEKVDAY
HTSQECSACGSMGARDGDHFSCSECNRGRHADLNASENIAQREGEPCTA

 

Blast result :
Comments
ISHarch20 is 95% aa similar to ISHbo7.
References
1] Friedhelm Pfeiffer (2015) Direct submission
2] Lucas,S., Han,J., Lapidus,A., Cheng,J.-F., Goodwin,L., Pitluck,S., Peters,L., Mikhailova,N., Teshima,H., Detter,J.C., Han,C., Tapia,R., Land,M., Hauser,L., Kyrpides,N., Ivanova,N., Pagani,I., Dyall-Smith,M., Cavicchioli,R. and Woyke,T. (2011) Direct submission to GenBank