ISHala3

  • Family IS200/IS605
  • Group IS1341
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
AOLZ01000079 ND Halobiforma lacisalsi
Halobiforma lacisalsi AJ5
DNA section
IS Length : 1468 bp

Ends


Left end : AGAATAATCGAGGCGGATGCCACGGGGCTTGACCCCGTGGAGGAAGCCGACACTCAATGAAACTCATTACGCTCGATAGCAAGGCCAACTCCTCACTCTA II struct. : Yes
Right end : GGGACGTTGAACGTGAACGGCGACTACACGCCTGCCGAGTTACTCGGTTAGAACGGGAGTCCACTGACAAGCCTCGGGGCTTGACCCCGAGGTAGTTGAC II struct. : Yes

Insertion site


Left flankLE cleavage siteRight flankRE cleavage site
TGATGGGCATATTCACACAGTAGTTTGTtgac

DNA sequence

AGAATAATCGAGGCGGATGCCACGGGGCTTGACCCCGTGGAGGAAGCCGACACTCAATGAAACTCATTACGCTCGATAGCAAGGCCAACTCCTCACTCTA
CACCTAAATTTTTATTAGGCAATACACGCAAATGTGAACCACAGATGGACGACAGCGCGCCACGACGCACCGTCCCCATCAAACTCGCTGTACCACAAGA
GCGTCGTGGCGACCTCCATCAAACCAAAACCCAATTCCTGCACTGCACCAACTGCACCAGCGAGTGGGCGTGGCGCTACGACGACTACTGCATCACCAGT
AAGAACAAAGCCGAAAACGCCCTCTACGACGAGCTACGTGAGGAAACCAACCTCACTGCCAACCTCGTCCAGAAAGGCATCCGACGCGCCATCGAAGCCG
TCGATGCAGGCGTCGAAAAGTTGAAGAAAGGCGAGAAAACGAGTCAACCCAAGTTCGACTCGTGGAGCGTCGTCTACGACAAGCGGAGTGCGACGTTCAA
CGCCGACCACGCCACGCTCTCCACTCCAAACGGTAGAGTTACCTGCGAATACGTTCTCCCGCCCGAAGACGAGCGCGAGGACACGCCGTTCGGACGGTAC
TACGAGAGCGACGACTGGGATGCGTCGAGTGCCACACTTCAGTACGGCGAGCAGGACGACACGTTCTACCTGCACGTCACGCTGAAGAATCCCGACTACG
AGGTTGACGGGACGGAACGCCAAGAAAGCGAGTCACGTGATGACACCACCGAGAACGGAGTGGTTCTCGGCGTGGACTTGAACGTGACTGGCGCGTTCGC
CGTCACCAGTACTGGGGAGTTCATCGGCAGTGCAGACTACCTCACCCACAAACGTGACCAGTACGAGCAGCGCCGCAAACGCCTGCAACAGACGGGTACA
CGGTCAGCGCACCTGACGATTCAGTCCATCGGTAGCCGCTTCTCGGATTGGTCGCTGGACTGGTTGCACAACCGCGCCAACGACCTCATCGCGGAAGCCC
AAGACGCAGATGTGGACGGCATCATTTTCGAGAATCTTGACCACATCCGCGAGAACATCGCCGACGGGTCGAAGTTCCAGCAGTGGGCCTACGCGAAGTT
CGTGGAACTCGTGAAGTACAAGGTCGAATCCACGACGTTGTTCGTGGATACGGTGAATCCTGCGTACACGAGTCAGAGGTGTTCGCACTGTGGGTTTACT
CACGAGGACAATCGCGACGACAAGGAGTTCAAGTGTCAGTCGTGTGGGTACGAGGTGAACGCAGATTACAACGCGGCGAAGAACATCGCCAACCGATACT
GCGGGTATATCCATCGCGGGCAGAAGTCTCGCGGTGGATGGGCCGCCAGTCAACTGGCCCTCAAGTCAGGGACGTTGAACGTGAACGGCGACTACACGCC
TGCCGAGTTACTCGGTTAGAACGGGAGTCCACTGACAAGCCTCGGGGCTTGACCCCGAGGTAGTTGAC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1275 bp424 aa1451419+No
ORF function : Accessory Gene
AG : TnpB

ORF sequence :

MDDSAPRRTVPIKLAVPQERRGDLHQTKTQFLHCTNCTSEWAWRYDDYCITSKNKAENALYDELREETNLTANLVQKGIRRAIEAVDAGVEKLKKGEKTS
QPKFDSWSVVYDKRSATFNADHATLSTPNGRVTCEYVLPPEDEREDTPFGRYYESDDWDASSATLQYGEQDDTFYLHVTLKNPDYEVDGTERQESESRDD
TTENGVVLGVDLNVTGAFAVTSTGEFIGSADYLTHKRDQYEQRRKRLQQTGTRSAHLTIQSIGSRFSDWSLDWLHNRANDLIAEAQDADVDGIIFENLDH
IRENIADGSKFQQWAYAKFVELVKYKVESTTLFVDTVNPAYTSQRCSHCGFTHEDNRDDKEFKCQSCGYEVNADYNAAKNIANRYCGYIHRGQKSRGGWA
ASQLALKSGTLNVNGDYTPAELLG

 

Blast result :
Comments
ISHala3 is 93% (TnpB) aa similar to ISHti11.
References
1] Friedhelm Pfeiffer (2015) Direct submission
2] Becker,E.A., Seitzer,P., Tritt,A., Larsen,D., Yao,A., Wu,D., Darling,A., Eisen,J.A. and Facciotti,M.T. (2012) Direct submission GenBank.