ISHez3

  • Family IS200/IS605
  • Group IS605
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
ATXS01000001 ND Halorubrum ezzemoulense
Halorubrum ezzemoulense DSM 17463
DNA section
IS Length : 1955 bp

Ends


Left end : CAGGCGGAGCAGGCCGAGTGCCTCGGGGCTTGACCCCGAGGGTGAAGGCCGTACGCTCCGCTAAACGTGTTCCGTTCGCTCGATATACTGTTCAATAGTG II struct. : No
Right end : GTGACCCACGACACCGCTAGAGGGTATCAGACCGATGGTGTCGTGGGAGTGTCCGACTGACCCACGGGAAGCCTCGGGGCTTGACGCCGAGGCGGTTCAC II struct. : No

Insertion site


Left flankLE cleavage siteRight flankRE cleavage site
AACTGACGGCCGTCTACTGATCTAGTGT

DNA sequence

CAGGCGGAGCAGGCCGAGTGCCTCGGGGCTTGACCCCGAGGGTGAAGGCCGTACGCTCCGCTAAACGTGTTCCGTTCGCTCGATATACTGTTCAATAGTG
CCGGTCGAAACATCGCCTGCCGTCCCAACGTAGTACGATTCCTCCCAGAATCCACCGCCCCACAGGTAGTCTTCCAAGAACGCTTCGTGCTGTTCCCACA
TCTCCCGCGCTGTGATGCTTTTGACCGTCCGTACAATCTCGCTCGGTGAGTGCTTCGGGTGAGCGGAGACAAACAGATGTACGTGGTCGGGCGAGATGTG
TAGCGACAGTATCTCGTAGCCGTATTCGTCGCACACGTCGCGGAAACTTGCTTCCAGCGATTTCTCGATTGGTGCGAGTATCGCGTGGCGGTACTTCGGC
CACCACACGAAGTGGTAGTTGACGTTGTACACCGTGTGGTTAGACCGCTTCTCACCCATACAGACAGTACTTGGACAAGAATTAAGTATTTCAGTAAGAG
TGTGAGATGACGAAACGACTGTCCGTGGACTTCGAGGACGATGTGTACAAGGAGTTCTCGAAGAAGTGCATCGAGGTTGACGAAACCAAGTCCGACGTAG
TGCGCGGACTCGTCAACGACTGGCTCGACGAATCCGGAGGATGACCGACGCACAGGCCCTCGTCAAGACGCTGGACTTCCAACTCGACATCCAGAGTGAC
AACGGGGGCCTGCTATACGATGCCACCCTCGAAGCCCGCTCAGTATACAACGAAACTATCCGACTCGCCAAAGATGGCGTGGACTGGGACACCATTCCCG
ACCGAGTAGCCGACGACGCTAACCTCGTGAAGAACACGACTCAGCGCGTCGTCGCCAAAGCACTCGGAGCGATGGAGAACTACTACGAGTACGACGACTT
CGGCCAGCCAAGTCACACCAAGGACGGTGCGTACCCGCTTCGTGCGAACTACGAGGAAGGGTACAATCTGTCGCTCACCGATGGCGGTGACGTGGTGTTC
CGCATCAGCGCGAAGCCGTACAACCACGTCAGGGGCGTCCTCAAAGGAAGTGACGCCAACCTCGACATTCTCCAGACCGCACTCGAAAGCGACGAGTGGA
AGATTGGGACGGCTGAAGCCCTGTTCCACAACGATACCCCTGAGTTGCACGTCAACGTCACCAACACCGAACAGACCGTTCGAGGCAAGCAGGACTCGCG
GACGGTCGTCGGTGTGGACGTGAACGAGGACAACGTAGCCCTCACCGCTCTGTCCGAAGATGGCGTTGAGGACACGTTGGTCATCAGCTTCCCCGAAATC
AAGTTCGAGCGTCACCGCTACTTCACGATGCGGAAGCGTGTGCAGAACGCGGGGAAAGACAGCATCCACGACACCCTCAAAGGGCGCGAAGAACGGTTTG
TCCGCGATCGACTCCACAAGGTGTCTCAGCATATCGTGGAGTGGAGCCGTCAGTTCGAGAAACCGTGTATCGTCTTTGAAGACCTCAAAGAGATGCGCGA
CAGTATCGACTACGGCACGCGAATGAACCGACGCTTGCATCACCTCCCCTTCCGCGCTCTCCAGTTCTATACGTCGTACAAGGCGGCTTTCGGAGGCATT
CCGACCGCGTGGATTAACCCCGGGTACACGAGCCAGCGGTGTCCGATGTGCGGACACACGGAGCGTGCGAACCGCAATAAGAAGCGGTTCAAGTGCAAGG
ACTGTGAACATCAAGACCACAGCGACCGTGGTGCAAGCGTCAATATCGCCGTGAAAGGCAGCAAGAAACTCGATTGGAATGTGCCTGCTCTCAACAGCCT
TCCCGTTGTTCGGACGGTGCGACGGCAGGCATCGGGGGCCGTGGACGCCCCGACCGTGACCCACGACACCGCTAGAGGGTATCAGACCGATGGTGTCGTG
GGAGTGTCCGACTGACCCACGGGAAGCCTCGGGGCTTGACGCCGAGGCGGTTCAC
Protein section
ORF number : 2

 

ORF 1
LengthBeginEndStrandFusion ORF
399 bp132 aa45961-No
ORF function : Transposase
Chemistry : Y1

ORF sequence :

MGEKRSNHTVYNVNYHFVWWPKYRHAILAPIEKSLEASFRDVCDEYGYEILSLHISPDHVHLFVSAHPKHSPSEIVRTVKSITAREMWEQHEAFLEDYLW
GGGFWEESYYVGTAGDVSTGTIEQYIERTEHV

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
1275 bp424 aa6411915+No
ORF function : Accessory Gene
AG : TnpB

ORF sequence :

MTDAQALVKTLDFQLDIQSDNGGLLYDATLEARSVYNETIRLAKDGVDWDTIPDRVADDANLVKNTTQRVVAKALGAMENYYEYDDFGQPSHTKDGAYPL
RANYEEGYNLSLTDGGDVVFRISAKPYNHVRGVLKGSDANLDILQTALESDEWKIGTAEALFHNDTPELHVNVTNTEQTVRGKQDSRTVVGVDVNEDNVA
LTALSEDGVEDTLVISFPEIKFERHRYFTMRKRVQNAGKDSIHDTLKGREERFVRDRLHKVSQHIVEWSRQFEKPCIVFEDLKEMRDSIDYGTRMNRRLH
HLPFRALQFYTSYKAAFGGIPTAWINPGYTSQRCPMCGHTERANRNKKRFKCKDCEHQDHSDRGASVNIAVKGSKKLDWNVPALNSLPVVRTVRRQASGA
VDAPTVTHDTARGYQTDGVVGVSD

 

Blast result :
Comments
ISHez3 is 94% (TnpA : the transposase and TnpB) aa similar to ISH36.
References
1] Friedhelm Pfeiffer (2015) Direct submission
2] Kyrpides,N., Huntemann,M., Han,J., Chen,A., Mavromatis,K., Markowitz,V., Palaniappan,K., Ivanova,N., Schaumberg,A., Pati,A., Liolios,K., Nordberg,H.P., Cantor,M.N., Hua,S.X. and Woyke,T. (2013) Direct submission GenBank.