ISDsac1

  • Family ISNCY
  • Group ISDol1
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
CP003639 ND Desulfosporosinus acidiphilus
Desulfosporosinus acidiphilus SJ4
DNA section
IS Length : 1646 bp

Ends


IR Length : 16/17

IRL : GATTCCCCTGAAAAACTAACCGATATTTTCAAAATGGCCAAAATAAAAGG
IRR : GATTCCCCTGAAAAAGTCGGTTAAAAAATACTCGTTTTAAACTCGTCTGG

Insertion site


Left flankDirect repeatRight flankDR Length
AAGCAGCTCCGTAATTAAGAAGATTTAC6

DNA sequence

GATTCCCCTGAAAAACTAACCGATATTTTCAAAATGGCCAAAATAAAAGGAATTCCCAAGGATTTGGTAGAAATTTAGAAGTGACAAGCAACCAAATTCT
ACTACCCTTTTGGAGAATTCCTAGTTTTTAGATTCTCCAAGAGGGTGAAAAAATCCTTTCAGGGGGTCAAAAAATGTTACGTCTTCACAATGAGCAACTT
ACTATTTGGGATTTTGCTTTACCTGAGCAAGTTCTAGAACTAAGCAAGGAATTAAAGACTATCGATGAACTTCTGGATGATGAGAAATTTATGCGGCCTT
TCCTTTCTCGTTGGAATATACGTATTGGCCGACCGACAGTTCCTGTCGAAACCTTTCTTCGTCTCATGTACCTTAAGTTCCGTTATGAGTTTGGTTATGA
AACTCTCGTTGCAGAGGTTAGTGACAGCATTAAATGGCGTCGCTTTTGTCGAATTAACTTAGATGCGACAGTTCCTCATAGTACGACCTTGATTAAACTG
ACTCAAAAGTATGGAGAAGACATCGTTGAACAGCTTAATGAAGCTCTCGTTGTTAAGGCTTCTCAAGACAAGATTACTCGGAGCCGGAGACTTCGCACGG
ACACAACGGTGACGGAATCCAATATTCATTACCCTACGGATGCTCAGCTCTTGGCCGATGCTATTAAATCGATAACACGCCAAGCTCAAAGCCTTCGAGA
AACTGCGGGTTCGACGATGCCCAAGATGATTGAACGCTGTCGTTCAGCGAAGAAGCGAATTTTGGAAATCGGTAAAACACTTAAGCGGCGTAATCATCAG
GCTGTTGAAGAAGTTCGTAAGATTACCGATAAATTAGTTGATAAAGCCATTGAAACTATGACTAACGCCCATCAGATTATGGATAAAGCCGAAGAAGCTC
TAGGCGAGCAGATGAGCAACACTACAAAACGCAAGATTGAGAAACTCGATAAGGTCATAGTCACCGCCGACAAAATTGTGAATCAAACACTAAAAGTCAA
CGGCGGAAACACCCACATTTCGAATCGAGTGATTAGTCTTCATGATCCAGATGCACGGCCGATTCAAAAAGGGAAATTAAAGAGTCCGACAGAGTTTGGC
TATAAAACAGAGATCACAGAAAATGAAGACCGCATTATAACCGATTATAAAGTTCATGTTGGAAATCCTAGTGATGACAGTCTTTTGGTAGAAACTGTTA
AACGTCATATTTCTAAAACAGGAAAAGTGCCATATTCAATCGCTACCGACAGAGGTTACAGCAGCGGTAAGAACCAAAAAGAACTGACTGACCTAGGAAT
CAAACGAATATCGATGCCTAAAAAGGGCAAGAAGAGTAAAGCACAGGCATCTCACGAAAAGCAGAGATGGTTCCGACGATTGCAAGCTTGGAGAGCTGGC
GGAGAAGGTACCATAAGCATTTTGAAACGGAAATATGGTCTAGGGAGAAGTCTGTCCCGAGGCCACCAAGGTGTAAGTACCTGGGTGGGATTTGGGATAT
TAACCTACAATTTGAGACGAATAGCGGCCCTGATTTAGAGGAAACCGAGAAATGGCAAGGGGTATTTGAGTATAAAGCTTAAAAACTATGTTGTTTCCAG
ACGAGTTTAAAACGAGTATTTTTTAACCGACTTTTTCAGGGGAATC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1365 bp454 aa1741538+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MLRLHNEQLTIWDFALPEQVLELSKELKTIDELLDDEKFMRPFLSRWNIRIGRPTVPVETFLRLMYLKFRYEFGYETLVAEVSDSIKWRRFCRINLDATV
PHSTTLIKLTQKYGEDIVEQLNEALVVKASQDKITRSRRLRTDTTVTESNIHYPTDAQLLADAIKSITRQAQSLRETAGSTMPKMIERCRSAKKRILEIG
KTLKRRNHQAVEEVRKITDKLVDKAIETMTNAHQIMDKAEEALGEQMSNTTKRKIEKLDKVIVTADKIVNQTLKVNGGNTHISNRVISLHDPDARPIQKG
KLKSPTEFGYKTEITENEDRIITDYKVHVGNPSDDSLLVETVKRHISKTGKVPYSIATDRGYSSGKNQKELTDLGIKRISMPKKGKKSKAQASHEKQRWF
RRLQAWRAGGEGTISILKRKYGLGRSLSRGHQGVSTWVGFGILTYNLRRIAALI

 

Blast result :
Comments
ISDsac1 is 66% aa similar to ISPeth1.
References
1] ISfinder annotation (2015)
2] Pester,M., Brambilla,E., Alazard,D., Rattei,T., Weinmaier,T., Han,J., Lucas,S., Lapidus,A., Cheng,J.F., Goodwin,L., Pitluck,S., Peters,L., Ovchinnikova,G., Teshima,H., Detter,J.C., Han,C.S., Tapia,R., Land,M.L., Hauser,L., Kyrpides,N.C., Ivanova,N.N., Pagani,I., Huntmann,M., Wei,C.L., Davenport,K.W., Daligault,H., Chain,P.S., Chen,A., Mavromatis,K., Markowitz,V., Szeto,E., Mikhailova,N., Pati,A., Wagner,M., Woyke,T., Ollivier,B., Klenk,H.P., Spring,S. and Loy,A. (2012) J. Bacteriol. 194 (22), 6300-6301.