ISRama1

  • Family IS1595
  • Group ISSod11
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
CP010801 ND Ralstonia mannitolilytica
Ralstonia mannitolilytica SN82F48 plasmid pRMAN01
DNA section
IS Length : 1090 bp

Ends


IR Length :

IRL : AAGGGCTATCCACTTAGCTCCAGCCATGCCAGAATCACTGGATGGATATA
IRR : GTGGGGTATCCACTTAGCTCCACCAGCACAGGATAACTGGATGGATATAC

Insertion site


Left flankDirect repeatRight flankDR Length
AAACAACTGTATATATGTACAGTATATC8

DNA sequence

AAGGGCTATCCACTTAGCTCCAGCCATGCCAGAATCACTGGATGGATATACAGGTAAAGCAGATATTACCCCCAGAACCGGGGAAGGACTACCCCCGTAA
CTGGAACGAGTTTCTGGACCGGTTCGGGACGGAAGAGGCTTGCCTGTCCTACCTGGAGGGATTGCGGTGGCCGCAGGGGTTCGTTTGCCCTGATTGCGGC
GTAGCGGCCGAGCCTTATCGGTCGAGCCGCACGCGCCTGATGTGTCGCAGTTGCGCTCACCAAACGACGGTGACCGCTGGCACGATATTCGACAAGACCC
GTACCCCGCTACGTGTGTGGCTGGCTGGTGCGTGGTATCTGACCAATCAAAAGCAAGGCGTCAGCGCCCTTGGTTTGCAACGGGTGCTAGGCCTGGGAAG
CTACCAGACCGCTTGGACGATGCTGCACCGGTTTCGCCGCGCTATGGTGCGACCGGACCGCGAACGCCTGAAGGGGTGTGTAGAGGTTGACGAGACCTAC
CTGGCCATCACGGACCGAGAGGCCCCTATCTCGGCCATCAACCGCAAGAACCGCACGAGCAAAGTGCTGGTCATCCTTGCGGTCGAAATGCTTCAGCCCA
AGGGCTTCGGCCGGATACGCTTGCAGCGCATCCAGAACGATGGCGCCGAATGCGTCATCCCGTTCATACAGGCGTCGATTGAGCCTGGCGCCCAAGTCAG
AACTGACGGGTCAGCAGCCTACCGGACATTGAGCAAGCTGGGTTACGAACACCAGCGCAATGTGATGCTGGGTGCCGAGGTGCCAGCTCACGTTTCGATG
GCTGGCGTTCATCGGGTTGCTTCACTGGTCAAACGCTGGATTCTCGGCACGCATCACGGCTCGGTTCAGCCCGAACATCTGGACGCCTACCTGGATGAGT
TCGTGTTCCGCTTCAATCGCCGCACCTCGGGCTCGCGCGGTCTCTTGTTCTATCGGCTGCTTCAGCAAGCGGTCGTTACCGGCCCTGTGACGTATGCGGA
TGTAGTGAACCGGGTCGAGACGGTGTAGCATACGAATACTGTATATCCATCCAGTTATCCTGTGCTGGTGGAGCTAAGTGGATACCCCAC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
987 bp328 aa421028+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MDIQVKQILPPEPGKDYPRNWNEFLDRFGTEEACLSYLEGLRWPQGFVCPDCGVAAEPYRSSRTRLMCRSCAHQTTVTAGTIFDKTRTPLRVWLAGAWYL
TNQKQGVSALGLQRVLGLGSYQTAWTMLHRFRRAMVRPDRERLKGCVEVDETYLAITDREAPISAINRKNRTSKVLVILAVEMLQPKGFGRIRLQRIQND
GAECVIPFIQASIEPGAQVRTDGSAAYRTLSKLGYEHQRNVMLGAEVPAHVSMAGVHRVASLVKRWILGTHHGSVQPEHLDAYLDEFVFRFNRRTSGSRG
LLFYRLLQQAVVTGPVTYADVVNRVETV

 

Blast result :
Comments
References
1] Thomas Jové (2015) Direct submission
2] Greninger,A.L., Miller,S. and Chiu,C.Y. (2015) Direct submission GenBank