ISRsy1

  • Family IS1595
  • Group ISSod11
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
FR854092 ND Ralstonia syzygii
Ralstonia syzygii R24
DNA section
IS Length : 1090 bp

Ends


IR Length : 44/53

IRL : AAGAGGTATCCACTTAGCTCCAGCTATGCCAGAATTACTGGATGGATATA
IRR : GTGGGGTATCCACTTAGCTCCACCAGCCCAGGATAACTGGATGGATATAC

Insertion site


Left flankDirect repeatRight flankDR Length
AGCGAACTGTATGAATATACAGCACGTC8

DNA sequence

AAGAGGTATCCACTTAGCTCCAGCTATGCCAGAATTACTGGATGGATATACAGGTAGAGCAGATATTACCTCCAGAACCGGGCAAGGACTACCCCCGCAA
CTGGAACGAATTTCTGGACCGGTTCGGGACGGAAGAGGCTTGCCTGTCCTACCTGGAGGCATTGCGGTGGCCGCAGGGGTTCATTTGCCCTGATTGCGGC
GTGGCGGCCGAGCCTTATCGGTCGAGTCGCACGCGCCTGATGTGCCGCAGTTGCGGCCACCAAACGACGGTGACCGCTGGCACGATATTCGACAAGACCC
GCACCCCGCTACGTGTGTGGCTGGCTGGCGCGTGGTATCTGACCAATCAGAAGCAAGGCGTTAGCGCCCTTGGTTTGCAACGGGTGCTGGGTCTGGGAAG
CTACCAAACCGCTTGGACGATGCTGCACCGGTTTCGCCGCGCCATGGTGCGGCCGGACCGCGAACGCCTGAAGGGGTGTGTTGAGGTTGACGAGACCTAC
CTGGCCATCACGGACCGGGAAGCCCCTATCTCGGCCGTCAACCGCAAGAACCGCACGAGCAAGGTGCTGGTCATCCTTGCGGTCGAAATGCTTCAGCCCA
AGGGCTTCGGCCGGATACGCTTGCAGCGCATCCACAACGATGGTGCCGAATGCGTTATCCCATTCATACAGGCGTCGATTGAGCCTGGCGCCCAAGTCAG
AACTGACGGGTCAGCGGCCTACCGGACATTGAGCAAGCTGGGCTACGACCACCAGCGCAATGTGATGCTCGGTGCCGAAGTGCCGGCGCATGTTTCCATG
GCCGGCGTGCATCGGGTCGCCTCACTGGTCAAACGCTGGATTCTCGGCACGCATCACGGCTCGGTTCAGCCCGAGCATCTGGATGCCTATCTAGATGAGT
TCGTGTTCCGCTTCAATCGCCGCACCTCGGGCTCGCGCGGCCTCTTGTTCTATCGGCTGCTTCAGCAAGCGGTCGTTACTGGCCCTGTGACGTATGCGGA
TGTAGTGCACCGCGCTGAGACGGTGTAGCATACGGATACTGTATATCCATCCAGTTATCCTGGGCTGGTGGAGCTAAGTGGATACCCCAC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
987 bp328 aa381024+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MDIQVEQILPPEPGKDYPRNWNEFLDRFGTEEACLSYLEALRWPQGFICPDCGVAAEPYRSSRTRLMCRSCGHQTTVTAGTIFDKTRTPLRVWLAGAWYL
TNQKQGVSALGLQRVLGLGSYQTAWTMLHRFRRAMVRPDRERLKGCVEVDETYLAITDREAPISAVNRKNRTSKVLVILAVEMLQPKGFGRIRLQRIHND
GAECVIPFIQASIEPGAQVRTDGSAAYRTLSKLGYDHQRNVMLGAEVPAHVSMAGVHRVASLVKRWILGTHHGSVQPEHLDAYLDEFVFRFNRRTSGSRG
LLFYRLLQQAVVTGPVTYADVVHRAETV

 

Blast result :
Comments
ISRsy1 is 89% aa similar to ISPosp3.
References
1] Thomas Jové (2015) Direct submission
2] Remenant,B., de Cambiaire,J.C., Cellier,G., Jacobs,J.M., Mangenot,S., Barbe,V., Lajus,A., Vallenet,D., Medigue,C., Fegan,M., Allen,C. and Prior,P. (2011) Direct submission GenBank.