ISHsp4

  • Family IS1595
  • Group IS1595
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
AXCA01000014 ND Halomonas sp.
Halomonas sp. PBN3
DNA section
IS Length : 1027 bp

Ends


IR Length : 22/27

IRL : CCTGATTACTCATGTTGATCAGCCACCACCTCGTCAGCCTGGCCTACACT
IRR : CCTGATTACGCATATGGCTCAGCCAGCTTCAGCAGCCGGTAAGGCATTGG

Insertion site


Left flankDirect repeatRight flankDR Length
ATGAGACCCTAAGAGTTTTTCCACATAC8

DNA sequence

CCTGATTACTCATGTTGATCAGCCACCACCTCGTCAGCCTGGCCTACACTGATGGTATATCCAGTAGAGGAGGCGGCGTCATGGCACGTAATCCTATCCA
GTTCCAGGCCGGCCTGTCGTTGCCGGCGTTTCTCGAGCAGTACGGCACGGAAGCGCAGTGCCGGGCGGCCCTCTACCGGCATCGCTGGCCCAAAGGGTTC
GTATGCCCCGACTGCGGCAACACCACCGGCTGCCGGTTATCGCGCGGGCTCTACCAGTGCCATCACTGCCATCATCAGACCTCGCTCACCGCCGGTACCA
TCTTCCATGGTACTCACCTGCCGCTGACCACCTGGTTCCTGGCGATCTATCTGCTCACCCAGCGCAAGAGCGGCATTTCGGCGCTGCAGCTGTCCCGGGA
GCTCGGCGTCACCTACAACACGGCCTGGAAGCTCAAACACAAGCTGCTGCAGGTCATGCTCGAGCGTAACCAGAGCGAGCGGCTTGGCGGGCGCATCGAG
ATCGATGATGCCTACCTGGGCGGCGAGCGGCCGGGAAAGCGCGGACGCGGCGCCGAGCACAAGTTCCCGTTCGTCGCCGCGGTGCAGACCGATGAGGCGG
GGCACCCTCGGCGCGTCCAGTTGCGCCGCGTGAGCGGCTTTACCCTGGCCGAGGTGCGCCGCTATGCCCGCGCCGCCATCGTACCCGGTAGTCGAGTGGT
CAGTGATGGCCTGGTGTGTTTCCGGGCCTTCGCGTCACTGGACTACCCCCATGAGCGCATCATCACCGGCAGTGGCCGTGCCAGCACGCAGATCCCTGCG
TTCAACTGGGTCAACACCGTGCTGGGCAACGTCAAGAACGCCATCACCGGCACTTACCATGCGATCCGTGGTCACCATGCCCCGCGCTACCTGGCCGAGT
TCGAGTACCGCTTCAACCGGCGCTATGACCTCAAGGCCATGCTGCCGCGCTTTCTGACGGTGGCGGCCAGAACACCGCCAATGCCTTACCGGCTGCTGAA
GCTGGCTGAGCCATATGCGTAATCAGG
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
942 bp313 aa811022+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MARNPIQFQAGLSLPAFLEQYGTEAQCRAALYRHRWPKGFVCPDCGNTTGCRLSRGLYQCHHCHHQTSLTAGTIFHGTHLPLTTWFLAIYLLTQRKSGIS
ALQLSRELGVTYNTAWKLKHKLLQVMLERNQSERLGGRIEIDDAYLGGERPGKRGRGAEHKFPFVAAVQTDEAGHPRRVQLRRVSGFTLAEVRRYARAAI
VPGSRVVSDGLVCFRAFASLDYPHERIITGSGRASTQIPAFNWVNTVLGNVKNAITGTYHAIRGHHAPRYLAEFEYRFNRRYDLKAMLPRFLTVAARTPP
MPYRLLKLAEPYA

 

Blast result :
Comments
ISHsp4 is 89% aa similar to ISMrsp2.
References
1] Thomas Jové (2015) Direct submission
2] Overholt,W.A., Green,S.J., Marks,K.P., Venkatraman,R., Prakash,O. and Kostka,J.E. (2013) Genome Announc 1 (6), e01015-13