ISRtr6

  • Family ISNCY
  • Group ISDol1
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
CP004017 ND Rhizobium tropici
Rhizobium tropici
Rhizobium tropici CIAT 899 plasmid pRtrCIAT899b
Rhizobium freirei PRF 81
DNA section
IS Length : 1666 bp

Ends


IR Length : 16/17

IRL : GTTTCCGTCCACGAACATCAAGTTATTGATATTATTAAGTGAATCTGAAT
IRR : GTTTCCGTCCACAAACAGGCGTATTTAAGCGCGTTTACAAGGGTTTGTCC

Insertion site


Left flankDirect repeatRight flankDR Length
TGGCGACTCTAGCTACGGGGAGCCC6

DNA sequence

GTTTCCGTCCACGAACATCAAGTTATTGATATTATTAAGTGAATCTGAATTTTGCGCAAGCAAGGCCCGGCGGTTTCAGGTATACTTTGGGCTCATGCCA
CTGATTCCGAAGCACAATCTGCAACCGCCGGAGCCGACAATGCGCCAGGAACGCACCGTCCAAGCCAGTATATTCGATCTTTTCGCCACGCACGAGATCG
GCCACGAACTGAAGTCGATGTCGCAGTGGCTGGACGAGCACCACGATCTGTTTGGCTTGGTGGGGCGGGATCTGGGTCGGCACGGCGTCAAGGCCACCGG
ACGGCAAGGGCTGCCGGCCGAGGCAGTGCTGCGTTGCGCATTGCTCAAGCAATACCGGCAGCTGAGCTACCAGGAACTGGCGTTCCATCTCGAGGACTCC
GCGTCGTTTCGGGCCTTTGCGCGCCTGCCGTGGTCATGGAGCCCGCAAAAGTCAGTGCTGCAAAAGACGATCAGCGCGATCCGACCCGAGACCTGGGAAG
TGATCAATCGGGCGCTGCTGTCGAGCGCTCGGCAGGCGAAGCTGGAAGACGGCACGGTCGTGCGGCTGGACAGTACAGTGACCTCGGCACTCATGCACGA
ACCGAGCGACAGCAGCCTGCTGTGGGATGCCGTGCGGGTCATGGTGCGCCTGCTGAAGAAGGCAGATACCTTGGTCGGCGCCGGCCTGGCATGGCGCGAT
CATTGCCGCGCGGCCAAGAAGCGTGCCCGCGAGATCCAGTTCACACGCGGTCAGCCCAATCGGGTCCGGCTCTACCGTGAGCTGATCGCGATCGCCTGCG
CGACCTTGGCATACCTGAAGCAGGCAACCGAGCGACTGGCAGCGGCGAGCAATCCGCTCGTCCAACTCTGGCAGGCCCAGGTTTGCCGCTATCGACCGCT
GATCGAACGCATCATCAAACAGAGCGAGCGGCGAGTACTGGCGGGCGAGAAGCTGCCGGCGGGCGAGAAGCTGGTAAGCCTGTTCGAACCCCATGCCGAT
ATCATCGTCAAAGGTAGCCGCGAGACCGAATACGGCCACAAGCTCAACCTGACCACCGGCAGAAGCGGCATGATCCTCGATCTGGTGATCGAGGCAGGTA
ATCCGCCCGACAGCGAGCGGCTGCTGCCGATGCTGGAGCGCCACATCGCCGTCTATGGAAACGCGCCGCGGCAGGCGGCGGCCGACGGCGGCTTTGCCAG
TCGCGGCAACCTGGCCACAGCCAAGACCTGGGGCGTTCGCGACATGGCATTCCACAAGAAAGCTGGCCTCAAGGTCGAGGACATGGTCAGAAGCAATTGG
GTCTATCGCAAGTTGCGCAACTTCCGCGCCGGTATCGAAGCCGGAATATCATGCCTCAAGCGTGCCTACGGCCTGGCACGCTGCACCTGGCGGGGCCTTG
ACCACTTCAAGACCTACGTCTGGTCCTCCGTCGTGGCTTACAACCTCGTCCTCTTCATCCGCCTCAAACCGACCTGAACTCCGACCAGCTTTTAGAATTG
CGCCGTCGCTACAATGCCGGCCTCGTGGCGTACGCCTCAGCGCCGCCAACTGTATACTGCCCAATCACAAGCGTTCATGATCCTGTCCGTCGCCCCAAAA
CCACTCTCACCGCAAAGGACAAACCCTTGTAAACGCGCTTAAATACGCCTGTTTGTGGACGGAAAC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1338 bp445 aa1401477+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MRQERTVQASIFDLFATHEIGHELKSMSQWLDEHHDLFGLVGRDLGRHGVKATGRQGLPAEAVLRCALLKQYRQLSYQELAFHLEDSASFRAFARLPWSW
SPQKSVLQKTISAIRPETWEVINRALLSSARQAKLEDGTVVRLDSTVTSALMHEPSDSSLLWDAVRVMVRLLKKADTLVGAGLAWRDHCRAAKKRAREIQ
FTRGQPNRVRLYRELIAIACATLAYLKQATERLAAASNPLVQLWQAQVCRYRPLIERIIKQSERRVLAGEKLPAGEKLVSLFEPHADIIVKGSRETEYGH
KLNLTTGRSGMILDLVIEAGNPPDSERLLPMLERHIAVYGNAPRQAAADGGFASRGNLATAKTWGVRDMAFHKKAGLKVEDMVRSNWVYRKLRNFRAGIE
AGISCLKRAYGLARCTWRGLDHFKTYVWSSVVAYNLVLFIRLKPT

 

Blast result :
Comments
ISRtr6 is 88% aa similar to ISRle10.
References
1] ISfinder submission (2016)
2] Ormeno-Orrillo,E., Menna,P., Almeida,L.G., Ollero,F.J., Nicolas,M.F., Pains Rodrigues,E., Shigueyoshi Nakatani,A., Silva Batista,J.S., Oliveira Chueire,L.M., Souza,R.C., Ribeiro Vasconcelos,A.T., Megias,M., Hungria,M. and Martinez-Romero,E. (2012) BMC Genomics 13 (1), 735.