ISArch22

  • Family IS5
  • Group IS903
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
LNGF01000018 ND Uncultured archeon
Uncultured archeon
Arc I group archaeon B15fssc0709_Meth_Bin003
DNA section
IS Length : 1031 bp

Ends


IR Length : 14/17

IRL : TGCTTTGTTGAATAATTCCTCTCAAATGAAGAGAAAAGCTTAAACCCCAT
IRR : TGCAGGGTTGAATAATTGTAGTTCAGTGGGAACACGGGCATCTTTTGCAT

Insertion site


Left flankDirect repeatRight flankDR Length
TGTTTTCCAAATAAATAGATTTGNNNN0

DNA sequence

TGCTTTGTTGAATAATTCCTCTCAAATGAAGAGAAAAGCTTAAACCCCATAAAAACCCCACCTTTTTATGCAGCGCAACTGGAGCAAATACAACGAGAGT
TTAGTTAAGAGGGGAGAATTTTACCTATCCCTAGATTTTTTAAGCAATTGGAGACGAGAATTAAATCGAATGAACAGGAATAAGCGTGGCAGGCCCTACG
CTTACACCGATTCATTCATCAAATTTACAGCTTTTTTGAAAACTGCTTTTGGCCTAGAGTACAGGCAGACCGAAGGAGTTCTTAGAGCTTTATCGAAGTA
TGTGCCCGGTGTAAAGGCTGCTGACTACACAACCCTATGGGTAAGATTTGCAAGAATGAAGTTCGAGTTACCAGAAGCACTTGATGATCCTGAAAGGGTA
GTTGCATTTGACGGCACAGGTGTCAAGGCCTCAAACAGGAGCGAATGGTACCAGATTATTTCCGGCAAGAAACGGAAGTGGATAAAGGTAATGATTGCAA
TAGATGTCAAGACAGGCGAGATTTTAGACGTAGTTGTAGCAGACGGCGCCTCAAGGGACAACGCCCTTTTCAAAGAGAAAGCTAGAAAGATTAAAATGAA
GGCGTTTATGGGAGACGGTGCATTCGATGACAAGGAGATATTTGATTACTGTGATGAAAATAACATACAACCCATAATAAAAATTAGAAAAGGCGCCTCC
CCAAAATCGAGAGGCTCCCGTTTGCGGCGAAAATGCATACGAGAGCTAGAGAAGATCGGACAAGAGGCCTGGAATGAGAAATATGACTACGGTAAGCGAT
GGTTGGTCGAGTCCTGTTTTTCAGCTGTAAAGCGCGCATACGGCGAGAGCGTAAGTGCCAAGAGGTTTGACATGGCCAAAAAGGAGGCCTTGCTAAAGTT
TATGCTCTACAGCGCTGTCAAAAATTCTTGCTAGGAAGGCAAGAAACTTTAGAAAATTTGCGGGGCAAGTATAAAATCAGGATGCAAAAGATGCCCGTGT
TCCCACTGAACTACAATTATTCAACCCTGCA
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
867 bp288 aa68934+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MQRNWSKYNESLVKRGEFYLSLDFLSNWRRELNRMNRNKRGRPYAYTDSFIKFTAFLKTAFGLEYRQTEGVLRALSKYVPGVKAADYTTLWVRFARMKFE
LPEALDDPERVVAFDGTGVKASNRSEWYQIISGKKRKWIKVMIAIDVKTGEILDVVVADGASRDNALFKEKARKIKMKAFMGDGAFDDKEIFDYCDENNI
QPIIKIRKGASPKSRGSRLRRKCIRELEKIGQEAWNEKYDYGKRWLVESCFSAVKRAYGESVSAKRFDMAKKEALLKFMLYSAVKNSC

 

Blast result :
Comments
ISArch22 is 60% aa similar to ISMth3.
References
1] ISfinder annotation (2016)
2] Nobu,M.K., Narihiro,T., Kuroda,K., Mei,R. and Liu,W.T. (2016) ISME J. In press.