ISLil3

  • Family IS5
  • Group IS903
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
JH597773 ND Leptonema illini
Leptonema illini DSM 21528
DNA section
IS Length : 1109 bp

Ends


IR Length : 16/18

IRL : GGCTTTGTTGCGCAAAAAAGGCTTGTACTGTGCGGCCCTAGCGACATAAC
IRR : GACTTTGTTGCGCAAAGATTATCCGAGCCAATAGCCTCCCGGATTTCAAT

Insertion site


Left flankDirect repeatRight flankDR Length
CAACAAAGCCGTAGTCTTTCGCGTTAGTC9

DNA sequence

GGCTTTGTTGCGCAAAAAAGGCTTGTACTGTGCGGCCCTAGCGACATAACGATATTATGAGCGCATTGCGGATAAAGGGAAAGCAAGATCCAAAGGTTCC
CTATCGAGTTCTGAACTGGAGAGATTACAACAGAGGGCTCGTTAAGCGAGGGGATCTCTGTCTCTGGATAGAGGATGGAATTGAGGATCGCTGGTATTCC
GTGGAAACACCGAATCGCCGGGGAAGAAGAGATAAATACTCTGATGCTGCTATTGAATGCGTTCTCGTTTTGAAGAGTCTCTTCGGGCTGCCTCTACGGC
AAACAACGGGGCTGCTGGCATCGCTTTTCAAGCTCTCCGGATTGGATCTGGAAGTACCGGATTACAGTCGAATCTCACGCAGACAGGGTCGGCTCTCCCC
TTCTATCAAATTGCCGAAGGGAATCCGATCAAAACCAATTCATCTTGTACTCGACGGAACGGGGCTCAAGGTTTTCGGCGAAGGCGAATGGAAAGTTCGC
GAGCACGGTGCGGGGAAACGAAGGACATGGCGCAAGCTTCATCTTGCCATTGATGCAGGTAGCGGACAGATACTGACTGCGTTACTAACCCAGCGTGATA
CTCACGATGCGGAGCCCGCACCCGATATCATTCGATCACTCGTAAAGCAAGGCTATGACATAAAGGATTTTCGCGGGGATGGAGCGTACGATGCTCATAG
AGTGTTTCTGACATGCTTGCAGCATGGAATCAAAGCCATTATTCCAAGCAGGGAAGGAGCCATTCTATCAAGCGAAAAATACGAGAATGCCATGGATAAT
ACCTGGCCACGCGATGAAATCGTGAAAAGAATTCGGGAAATCGGAAAAGGAGGTTGGAAGACAGAGAGCGGATATTTCAAACGATCACTTGTAGAAATGG
CAATCTATCGCTACAAGCGAACGTTCGGTGACCGCCTGAGCGCTCGTAACCTTGAGAATCAGCGAGTAGAGGTCACATTGCGGGCCTCTATGCTTAATAA
AATGATCAAGACGGCTAAACCGAAGTCAGAGAAGCGGATCAGGTAATAAACGTTCTGGAATTGAAATCCGGGAGGCTATTGGCTCGGATAATCTTTGCGC
AACAAAGTC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
990 bp329 aa571046+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MSALRIKGKQDPKVPYRVLNWRDYNRGLVKRGDLCLWIEDGIEDRWYSVETPNRRGRRDKYSDAAIECVLVLKSLFGLPLRQTTGLLASLFKLSGLDLEV
PDYSRISRRQGRLSPSIKLPKGIRSKPIHLVLDGTGLKVFGEGEWKVREHGAGKRRTWRKLHLAIDAGSGQILTALLTQRDTHDAEPAPDIIRSLVKQGY
DIKDFRGDGAYDAHRVFLTCLQHGIKAIIPSREGAILSSEKYENAMDNTWPRDEIVKRIREIGKGGWKTESGYFKRSLVEMAIYRYKRTFGDRLSARNLE
NQRVEVTLRASMLNKMIKTAKPKSEKRIR

 

Blast result :
Comments
ISLil3 is 64% aa similar to ISLil2.
References
1] ISfinder annotation (2016)
2] Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Dalin,E., Tice,H., Bruce,D., Goodwin,L., Pitluck,S., Peters,L., Mikhailova,N., Held,B., Kyrpides,N., Mavromatis,K., Ivanova,N., Markowitz,V., Cheng,J.-F., Hugenholtz,P., Woyke,T., Wu,D., Gronow,S., Wellnitz,S., Brambilla,E.-M., Klenk,H.-P. and Eisen,J.A. (2011) Direct submission GenBank.