ISEc62

  • Family IS21
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
ND Escherichia coli
Escherichia coli E24377A
Escherichia coli plasmid p2075-10
Escherichia coli E24377A plasmid pETEC_74
Escherichia coli E24377A plasmid pETEC_73
DNA section
IS Length : 2125 bp

Ends


IR Length : 11/12

IRL : TGTCAACGCCAAGATTATTGGCCGTTTTTCGCCATTTTTAATGTCCGCTA
IRR : TGTCAGCGCCAATGATATAAGACAGTAATTCACCATTTGGATTGTCCGCT

Insertion site


Left flankDirect repeatRight flankDR Length
GATGTCCCGAAAGACGCACTGCGG4

DNA sequence

TGTCAACGCCAAGATTATTGGCCGTTTTTCGCCATTTTTAATGTCCGCTATTGGTCATTAATGTTGTCCGCTTTCCGCCATTTCATCATCACTGATTGGC
GTGGCGTTTTTTGCCAGCACTCCCGCTTTGCGTTTTTCCTTTAACCGGTAGCTTTCTCCTTTGATGTTCAGTGTGGTTGAGTGGTGGAGCAGTCGATCCA
GGATTGCCGTTGCCAGCACGTTATCGCCGAACATCTCTCCCCAGTCGGCGAACCCTTTATTTGATGTCAGCACGATGCTCGCTTTTTCATATCGACGGTT
CAGCAACCGGAAGAACAGACTGGCTTCCTCGCGGGTCATCGGCAGATAGCCTATCTCATCCAGTATCAGTACCCGGGCATAACCAAGCTGCTGTAGCTGT
TTTTCCAGCCGGTTTTCCTGTTTTGCCTTCATGAGTGTGGCGATCAGCTTATCCAGTGGCATGAACAGTACCCGATGACCAGCGTCCGCCGCTTTTACCC
CGAGAGCGACTGCCAGGTGCGTTTTACCCACACCGGGCGGACCCAGCAGGATCACGTTCTCGCTACGCTCCACGAACGCCAGCCCGGCCAGCTCACGGAC
GACCTTACGATCGATACCTGGCTGGAAGCCGAAGTCGAACTGCTCCAGCGTTTTGACCCACGGGAAGCGGGCCTGTTTCAGCCGGGACTCCATACCGCGC
TGATGCCTCCCGTTCCATTCCTGCTGCAACGCCATGCACAGGAACTCGCGGTAGTTCAGTTCTTTTTTGGCCGCCTGCTCCAGCAGGCTTTCAACGTGGT
AGCCCAGATGTTCCATTTTAAGACGACTCAGCAGTGTCTCCAGTTCATGCATCACAACAGCTCCTCATACGTACTCAACGGTCTGTGTTCCACCTGACTG
ACCTGCTGCCAGAGTGGGGCGTGATGCTCCGGCACGGTTTGCCAGCTGGATGCAGCCGAACAGAGACGGTGCGATGCTACCTGTTGCTCATTACTGTAGA
TCCGTAGTTCATCATCCAGCGAGATCCGTATTGATACCGGCTGGCCACACAGGCTTTCCGGTACGCTGTAACGGTTCCCGCCAACCTCGATATAGCCATC
CCAGGAGACATGACGGATATCGAAATAGCTGGTATCGAAGTCCGTACCCGGCAGCGGATGCAGATGCTCCTGTTCCTGCGTGAAGCGCTGTTCCGGTGTC
TGCCTGAACTGGCGAAGTTCTCGCCTGTCAGCAACGTCAGCCATCCACTGCTCCAGTAGCTGGTTAACATGGGCGAAGCTGTCGAACCGGCGGTACCGGA
CGAAGAAGTTTTCCTTGAGGTATTTCACCATCCGTTCAACCTTACCTTTGGTTCTGGCCCTTCGTGGACGGCAGGCCCGTGGCAGGAAGCCATAGTGATC
GGCCAGCAGCAGGAACCCGGAGTTGAACACCACCTTCCCATTGTTATTTTTCAGAACTGCGGCTTTCTGGTTATCGACCAGCACGGTTTTCACGCTACCG
CCGAAGTAGCGAAAGGCGCGGACCAGTGACTCATAGGTATGTTCAGCATCCTGCTTTGGTGCCGCGAAGACATGGAAGCGACGTGAGAACCCCAGCGTAT
TAACCGCGAAGTTAACCCTGCATCGTTGCCCGGCAACCTCAGCCTCAACTTCTCCCCAGTCATGCTGTAGCTGGTAACCGGGCTGAGTTTCGAAGCGAAC
CGTTTTCTTCGATGGCCGCATCTTACGTTTGGGCTGGATGTAGTAGCGCAACATGGAACGGCCACCGGTATAACCCATCGCTTTGATTTCCGCCAGGATG
ACCTCGCCGTTCCAGACGTTCTCAGCCAGACGCATATCTATATAGTCCATGAACGGCTTGAGTTTGGCCATTTTGTGGCGTGTTTTTCTGGCCGGAGGTT
CCGGGTATTTCAGGTACCGTCTGACGGTCCGCTCAGAGCAACCAACCTGAGTGGCAATATCAACAATATACGCACCTTGCTGGCGCATTTGCTTTATCAT
GTAAAAATCCTCTCTGCTCAGCATGAGTGTTCCCTTTGTGGTGTAGGAACCTTAAGGAAACAACATGTTGGGTGGAGCGGACAATCCAAATGGTGAATTA
CTGTCTTATATCATTGGCGCTGACA
Protein section
ORF number : 2

 

ORF 1
LengthBeginEndStrandFusion ORF
1173 bp390 aa1021274+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MLSREDFYMIKQMRQQGAYIVDIATQVGCSERTVRRYLKYPEPPARKTRHKMAKLKPFMDYIDMRLAENVWNGEVILAEIKAMGYTGGRSMLRYYIQPKR
KMRPSKKTVRFETQPGYQLQHDWGEVEAEVAGQRCRVNFAVNTLGFSRRFHVFAAPKQDAEHTYESLVRAFRYFGGSVKTVLVDNQKAAVLKNNNGKVVF
NSGFLLLADHYGFLPRACRPRRARTKGKVERMVKYLKENFFVRYRRFDSFAHVNQLLEQWMADVADRRELRQFRQTPEQRFTQEQEHLHPLPGTDFDTSY
FDIRHVSWDGYIEVGGNRYSVPESLCGQPVSIRISLDDELRIYSNEQQVASHRLCSAASSWQTVPEHHAPLWQQVSQVEHRPLSTYEELL

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
795 bp264 aa12742068+No
ORF function : Accessory Gene
AG : IS21 helper

ORF sequence :

MHELETLLSRLKMEHLGYHVESLLEQAAKKELNYREFLCMALQQEWNGRHQRGMESRLKQARFPWVKTLEQFDFGFQPGIDRKVVRELAGLAFVERSENV
ILLGPPGVGKTHLAVALGVKAADAGHRVLFMPLDKLIATLMKAKQENRLEKQLQQLGYARVLILDEIGYLPMTREEASLFFRLLNRRYEKASIVLTSNKG
FADWGEMFGDNVLATAILDRLLHHSTTLNIKGESYRLKEKRKAGVLAKNATPISDDEMAESGQH

 

Blast result :
Comments
ISEc62 is 96% aa similar to IS21.
References
1] Bortolaia, V. (2016) Direct submission
2] Katrine Hartung Hansen,, Valeria Bortolaia, Christine Ahl Nielsen, Jesper Boye Nielsen, Kristian Schønning, Yvonne Agersø and Luca Guardabassi. (2016) Appl Environ Microbiol. May 27. pii: AEM.00495-16.