ISEc63

  • Family Tn3
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
ND Escherichia coli
Escherichia coli plasmid p1967-1
DNA section
IS Length : 4473 bp

Ends


IR Length : 45/47

IRL : GGGGTTTGAGGGCCAATGGAACGAAAACGTACGTTAAGGAGATAATTCGT
IRR : GGGGTTTGAGGGCCAATGGAACGAAAACGTACGTTAAGAGCATAATTTGT

Insertion site


Left flankDirect repeatRight flankDR Length

DNA sequence

GGGGTTTGAGGGCCAATGGAACGAAAACGTACGTTAAGGAGATAATTCGTTGTTTATATTTAAATTTAGAGCTCTCAGCTCTCCTTTTAAAATATCCTCT
GGCAGTGTGAATGTATAATGGCCCAACATATTGATATGCCCGTGCATCAGGGGAGATAGCCGAGCGATATCTTCATCTATAATTTCTTCTCCATTACGGC
GCATCCAGCTCAACACTTCCTGCATATAGAGCGTGTTCCACAGAACCACTGCATTAGTAACCAGGCCCAGAGCCCCCAGTTGATCTTCCTGCCCTTCACG
ATAACGCTTTCTGATCTCTCCGCGTTGTCCGTAACAAATCGCACGAGCCACAGCGTGGCGGCCTTCTCCTCGATTGAGCTGCGTCAGGATCCGCCGACGA
TAATCTTCATCATCAATATAATTGAGGAGATATAGCGTTTTGTTTACACGCCCTACTTCCATAATTGCCTGTGCCAGTCCTGATGGGCGCGAGCTTTTCA
GTAAAGAGCGAATAAGTTCTGACGCATGAATTGTACCCAACTTCAGCGAACCAGCGGCTCGCATCATCTCATCCCACTGACTCTCCGCTTTTGACAGATC
TGCATATCCTCGGGCCAACTTATCCAGTACTCCGTAGTTTGCCGATTTATTCACCCGCCAGAACACCGCTTCACCTGCATCGGCAAGCCGGGGGGAAAAC
TGATACCCCAGTAGCCAGAACAGACCGAAAATAATATCGCTGCTACCCGCAGTGTCTGTCATGATCTCAACTGGATTCAGCCCTGTCTGCTGCTCAAGAA
GTCCTTCCAGTACAAAAATCGAATCCCGTAATGTACCGGGTACCACAATGCCATGAAAACCAGAGTACTGATCAGATACGAAGTTATACCAGGTGATGCC
TCGTCCAGAACCAAAATATTTTCTGTTAGATCCTGAGTTGATAGTCTTCACTGGTGTGACAAAACGCATGCCGTCAGCTGATGCCACTTCTCCACCTCCC
CAACGACCAGCAAGCTCCAGTGTGGACTGAAAATCAACTAGGCGGGCATTGGCGCTGACTAGCGTTTCTGCACGAAGGTAATTCTGTTTCACCCAACTGA
GCCGATGACGGGTCAGTGCTGGTATATTGTGCTTTATCAGCGGCTCCAGTCCGATATTACAGGCTTCAGCCATCAATACCGCACATAAACTGATGTGCAA
ATCTTGCGCTCGAGCACCAGATTCACTGACATGTGCAAACTCATGTGTAAATCCTGTCCGGGCATCTATCTCAAGTAACAGTTCCGTTAAATCTACCGGT
GGGAGTAGCTGTTTGATCCGATTATTTAGACGAAGCAACGATGGTGGCTCTTCCTGTTTCTCCAGACAACTGATAGTCAGGGATGGATATTTACCTTCAT
TACAGATATGAACTTCCGCATTCTTTTCAAATCGTGATGCCACGGCTTTCCAGGTCTCATCCAGCTGAATAGCCAGTTGTTGCACACCTTTACGTCCATC
GACAGGATGTCCCAGTGCCCGACAGACAGGAATACGCTGAGTCTGCCACTCTTCACCTTGCAACAACTTCTCGCGAGGATCTCCCCAGCGATCACTGCTT
TCAAGCCAGATGTCCCGGCGGCGCAGTGCATCCTGAAGGCGTTCCAGCAAACATAGTGAATAACCTGCACGCTGTATCCGTCCCTCCGCATCGTATACGA
GGCGTTTCCAGGGACCGGTGATAATATGTTCAGGCGCATCATCAAGGATGCGCTTTTTCGAACCATTCAGTTCTGCCAGATAATGAATCGCAGCCAGTAC
ATGTTCACCTGCCGGTGCCGCACGGAAATGCAGGTTCCGCAACACCGCCGGAAGAAAACGTTTAACCCGACCGTACTGCTCAACCATTTCGTCATGGAAA
TTATTGTTATGTGGACGAGCAAGTTCATTAACCTTACTTACAGATTCTGCCAGTCTGTTTTTGGGTACGTACTTGAAGATAACCTGCCTGAGATCTGGAA
CATCTGTATTATCATCCAGCAACAATGCACATGCCCGCGCCAGTAACAATGCGGCCTGATCAAGATCTTTCAGCGTCCTGAGTCTTTTTTTTTGCCCAGT
TTTCTTTGCTTCGCGGATAATGTCCAGAATTAGCATATCAAGCACATCAACGGCATCGTCCAATGCCGTTATTTCCTGCGCTTTAACGAATGCAGTAAGT
ACAGCAAGCTTTCTCTGCTGTGGCATTCGAGCGATATATTTTACCGACGCCATGCCAGCATAACGAGCCAGATTACGCAGTTGAATGGCAGGCAGGCCGG
AAAAGTTCAGTCGGGAAAACTCAAGGCTTCGTAATCGGATATATCGTTCCAGCGCCTCAGTAAACGCAGGTCCACTGACTGTAACAGGGCCTTTTTTCAA
CTGTTCCAGTGGTGATACACGCTGACCTTCCGGAATGACCAGAAGCTCCATCACTTGAGCTGCCTGCCATTTGTTCGGCAGTGCGGCCAGCTTTTTCCAC
AGCCGCTGATTTGCCCTTTCACGAATTTCACTGATGAGACGTACTAGTGTGGTTGCTCCGGGCAGTAATACCTTATTTTGAAGTAACCATGCAGTGGCAA
AATCAAACATCAGACCCGGTCGCTCATTACTGAGCCACGCCCGGGTATATAGCAGACGCTTCAGGCGGAAAGACCATGGAAAATCACCAAATTCATGATA
GCCGTAATATTCCTTAATTAATGCAGTATGTTCTCTAAGGGTAGTGTCCCGTTCAGCATAGCGGGAGAGAACTTCTGGACGGCGGATATTAAGCTGTACC
GCGACAAAATGTTGAACACCAGGCAGAACCTGAGTTAAATCCGTCAGAAATGTTCCCAGAAAACGGGCTGTGGTGAGCTGAAGTGCAATGCCCAGCCTAT
TATGTTTGCCCCGTCGTTGGTTAATGAAGGCCAGATCCCGTTCATCAAGATGAAAATAGCGCGCCAGTTGCACGTCATTAGGTTCTGCAGCATAACAACC
GTAATTCTTTTTCTGGTCAGAGGTTAGAAAGTCGACAGGCATATCAGGCTCCCTACCTGACAGTTATTCATTAACAATTTTGCAACCGTCCGAAATATTA
TAAATTATCAGACATATGAAAACAGTGCCGTTAATGTGTCTATTAAATCGATTTTTTGTTATAACAGACACTAGTTGTCCGATATTTGATTTAGGATACA
TTTTTATGCGACTTTTTGGTTACGCACGGGTATCAACCAGTCAGCAGTCTCTCGATATTCAGATCAAAGCGCTCAAAGATGCAGGTGTAAAAGCAAACCG
TATCTTTACCGATAAGGCATCCGGCAGTTCTACAGACAGGGATGGGTTGGATCTGTTGCGGGTAAAAGTAGAAGAAGGTGATGTCATTCTGGTGAAGAAG
CTCGACCGTCTTGGCCGCGATACCGCCGATATGATCCAACTGATAAAGGAATTTGACGCTCAGGGCGTCGCCGTCAGATTTATTGACGATGGGATCAGTA
CAGATGGTGATATGGGACAAATGGTGGTGACCATTCTGTCCGCAGTGGCACAAGCTGAACGCCGGAGGATACTGGAGCGTACAAATGAAGGCCGACAGGA
TGCAAAAATGAAAGGTATTAAGTTTGGCCGTAAACGCTCAGTGGACAGAGGTTCTGTGCTGGCGTTGCACCAGAAAGGTACAGGAGCAACAGAAATTGCC
CGTCAGTTAAGTATAGCCCGCTCTACGGTTTATAAAATTCTGGAAGAAGGGAAGGCAGAATAGGCCAATATTTACACAATTAACTAATATTTTCTACGCA
ATACGTGACACCTTTCGAGGAGAAGTGCTCGAAATTTCAGACATAAAAAGCCCCGTAGGGCCTTAGATGATTTCTTCCAATGCTGATTCCAGTTCTTTTA
CTTGCATTGCTCTAAGACGAGGAGCTAATGTTCGATGGGCGTTTAAGTAATCAATGGCTCTTGTTACCAGCTTTCCTCCGCCACAGACAACGAAATAACT
CTGATGTTGTGTGTGTTGTGCATCAAGAACTGTGTGGCCTAGCTTCTCTATTGCGGTACCACTCACTTCCTGCCATTTAGCCGTTATTTGAACGGTACCG
GTATTAGTGAACAACAGGAAGTGGGCTATTTCATTCTTTCCCGCGATCAGACCAGGATAACTGACATTTTTTTTAAACGTTATCGGAGCTTCTGAGTTAC
TTAGCTCAAAGCCTGCCCCAGAAATAATTGCTTCAATATCACGCAGTAATTCTGCTCTGGACATACTTTCACCTTATCGTGTTGTATCTTTTTTGATCTT
GGGGGAGGAGGCAGAATTTTCAAGATGTAGGCGTTTTATTTTATGGTTAATAATCACCGCCACTCTTATGGTGAGAGCATAAAAAATCCCCCACGAGCTT
TATTACTAAATTCAATACAAACAACAAATTATGCTCTTAACGTACGTTTTCGTTCCATTGGCCCTCAAACCCC
Protein section
ORF number : 3

 

ORF 1
LengthBeginEndStrandFusion ORF
402 bp133 aa210611+No
ORF function : Passenger Gene
Annotation : Hypothetical proteinDescription :

ORF sequence :

MSRAELLRDIEAIISGAGFELSNSEAPMTFKKNVSYPGLIAGKNEIAHFLLFTNTGTVQITAKWQEVSGTAIEKLGHTVLDAQHTQHQSYFVVCGGGKLV
TRAIDYLNAHRTLAPRLRAMQVKELESALEEII

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
648 bp215 aa1358711-No
ORF function : Accessory Gene
AG : Tn3 resolvase

ORF sequence :

MKTVPLMCLLNRFFVITDTSCPIFDLGYIFMRLFGYARVSTSQQSLDIQIKALKDAGVKANRIFTDKASGSSTDRDGLDLLRVKVEEGDVILVKKLDRLG
RDTADMIQLIKEFDAQGVAVRFIDDGISTDGDMGQMVVTILSAVAQAERRRILERTNEGRQDAKMKGIKFGRKRSVDRGSVLALHQKGTGATEIARQLSI
ARSTVYKILEEGKAE

 

Blast result :
ORF 3
LengthBeginEndStrandFusion ORF
3009 bp1002 aa14324440+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MPVDFLTSDQKKNYGCYAAEPNDVQLARYFHLDERDLAFINQRRGKHNRLGIALQLTTARFLGTFLTDLTQVLPGVQHFVAVQLNIRRPEVLSRYAERDT
TLREHTALIKEYYGYHEFGDFPWSFRLKRLLYTRAWLSNERPGLMFDFATAWLLQNKVLLPGATTLVRLISEIRERANQRLWKKLAALPNKWQAAQVMEL
LVIPEGQRVSPLEQLKKGPVTVSGPAFTEALERYIRLRSLEFSRLNFSGLPAIQLRNLARYAGMASVKYIARMPQQRKLAVLTAFVKAQEITALDDAVDV
LDMLILDIIREAKKTGQKKRLRTLKDLDQAALLLARACALLLDDNTDVPDLRQVIFKYVPKNRLAESVSKVNELARPHNNNFHDEMVEQYGRVKRFLPAV
LRNLHFRAAPAGEHVLAAIHYLAELNGSKKRILDDAPEHIITGPWKRLVYDAEGRIQRAGYSLCLLERLQDALRRRDIWLESSDRWGDPREKLLQGEEWQ
TQRIPVCRALGHPVDGRKGVQQLAIQLDETWKAVASRFEKNAEVHICNEGKYPSLTISCLEKQEEPPSLLRLNNRIKQLLPPVDLTELLLEIDARTGFTH
EFAHVSESGARAQDLHISLCAVLMAEACNIGLEPLIKHNIPALTRHRLSWVKQNYLRAETLVSANARLVDFQSTLELAGRWGGGEVASADGMRFVTPVKT
INSGSNRKYFGSGRGITWYNFVSDQYSGFHGIVVPGTLRDSIFVLEGLLEQQTGLNPVEIMTDTAGSSDIIFGLFWLLGYQFSPRLADAGEAVFWRVNKS
ANYGVLDKLARGYADLSKAESQWDEMMRAAGSLKLGTIHASELIRSLLKSSRPSGLAQAIMEVGRVNKTLYLLNYIDDEDYRRRILTQLNRGEGRHAVAR
AICYGQRGEIRKRYREGQEDQLGALGLVTNAVVLWNTLYMQEVLSWMRRNGEEIIDEDIARLSPLMHGHINMLGHYTFTLPEDILKGELRALNLNINNEL
SP

 

Blast result :
Comments
ISEc63 is 78% (ORF3 : the transposase) aa similar to Tn3.
References
1] Bortolaia, V. (2016) Direct submission
2] Katrine Hartung Hansen,, Valeria Bortolaia, Christine Ahl Nielsen, Jesper Boye Nielsen, Kristian Schønning, Yvonne Agersø and Luca Guardabassi. (2016) Appl Environ Microbiol. May 27. pii: AEM.00495-16.