ISPch1

  • Family IS1595
  • Group ISPna2
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
AVBG01000003.1 ND Pontibacillus chungwhensis
Pontibacillus chungwhensis
Pontibacillus chungwhensis BH030062
DNA section
IS Length : 1475 bp

Ends


IR Length : 24/29

IRL : GGCTCTGTTAAActcagttgttgatatttgctaaaatcgaacaaatgttc
IRR : GGCTCTGTTAAAgttcaatgttgatatttatagaaaaaaatataacttcc

Insertion site


Left flankDirect repeatRight flankDR Length
TCTCTCTCATTTtttaattaAAAAACCTGAAGC8

DNA sequence

GGCTCTGTTAAACTCAGTTGTTGATATTTGCTAAAATCGAACAAATGTTCTACAATGGAGTCAGAAAATATTAGTGGGTGATGACTGTGAGAGCAACCGA
TATTCTTAAAGCCATTCAAAAACTTAATCCTTCGGAAAAGCATCGTTTACGAGAATATTTAATAGATGCTCTTACTGCGTCATCCTTAACGGGAACCGTA
CTGGATGAAATCTCTGAACGTAAAAATAAGGATGGTTATCGTTGCCCCGATTGCGAGTCAGAACATATTGTGCGTTTCGGGAAATACTCCACTATCGTAG
AGGGTGAAGAAGTGAGGAAACAACGTTATCGCTGTAAAGCCTGTCGAAAGACCTTTACTGACCTCACCAATACGGCATTATATAGAACTCGTCATCTCCA
TCGTTGGATGAAGTTTATTGAATGTATGATAGAAGGATATTCGCTTCGTAAATCAACAGAGTTGATTGGTGGCGTTACTCATGTGACCTTGTTCTATTGG
AGGCACAAACTCTTGTCAGCACTAAAACAAATGGAAAGTTCAAAATTCCAAGGTATCGTTGAAATGGACGAGACCTATTTCCTATACTCAGAAAAAGGAC
AAAGGAAGATTGCCGATAGAAAACCTCGCCAACGGGGTGGTTCCGCAAAGAAACGCGGCATCAGTAACGAACAGGTATGTGTCTTAGTTGCAAGAGACCG
TGACAAGATGACCTTTTCCCAGACGTTAGGGATGGGACGATTAACAAAAGAGCAATTAGACAAAGCCATCGGGCATAAACTTTCCCACGAGAATGTATTA
TGCACCGATGCTTGGCGTGCCTTTAAAACCTATGCTGCTGAAAAGGAGTTATCGATTTACCAATTCAAATCTGACGGTAAAGTTCGCACCAAGGGTCTTT
ATCACATCCAAAACGTTAACAACTACCACCGAAGACTTAAAGGGTGGATACAGCGATTTAACGGTGTGGCGACTAAGTATCTGAACAATTATCTTGCGTG
GTTTCAAGTATTAGAAAGCATCCATCACCAAAGAAACGAAGTCACAATGAATGATATGATAGTAAAAGGAAATTTAATTCCAAGTGTGGAAACCTATGAT
ACACTAAGATTATCTAAGTTTACTGTATAAAGGTTATTTATTTACGAGGTTTTAATAGTGAAAGGAGGAATAGAAGATGTTCTCAAAAAAATACATGGGA
ATTGTTATTACAATTATCGGTGCAGTTATACTTATGGTTAGAGCAACTTTCCTATATTCCACTGTATATGCACAGATATTTCAAATAATAGGTCTTATTT
TATTTTTTGGTGGTGGAATACTTATTCCTGATTTTACAGGTGTACATAAACAAAAAAAAGAACAATAAACTTTGCGGATGACAATAAACCAAATATAACT
TCCTTTTGTGGAAGTTATATTTTTTTCTATAAATATCAACATTGAACTTTAACAGAGCC
Protein section
ORF number : 2

 

ORF 1
LengthBeginEndStrandFusion ORF
1050 bp349 aa811130+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MTVRATDILKAIQKLNPSEKHRLREYLIDALTASSLTGTVLDEISERKNKDGYRCPDCESEHIVRFGKYSTIVEGEEVRKQRYRCKACRKTFTDLTNTAL
YRTRHLHRWMKFIECMIEGYSLRKSTELIGGVTHVTLFYWRHKLLSALKQMESSKFQGIVEMDETYFLYSEKGQRKIADRKPRQRGGSAKKRGISNEQVC
VLVARDRDKMTFSQTLGMGRLTKEQLDKAIGHKLSHENVLCTDAWRAFKTYAAEKELSIYQFKSDGKVRTKGLYHIQNVNNYHRRLKGWIQRFNGVATKY
LNNYLAWFQVLESIHHQRNEVTMNDMIVKGNLIPSVETYDTLRLSKFTV

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
192 bp63 aa11771368+No
ORF function : Passenger Gene
Annotation : Hypothetical proteinDescription :

ORF sequence :

MFSKKYMGIVITIIGAVILMVRATFLYSTVYAQIFQIIGLILFFGGGILIPDFTGVHKQKKEQ

 

Blast result :
Comments
ISPch1 is 94% (transposase) aa similar to ISBse1
References
1] Thomas Jové (2016) Direct submission.
2] Wang,Q. and Wang,G. (2013) Direct submission GenBank.