ISPdo1

  • Family IS1595
  • Group ISPna2
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
CP016543 ND Planococcus donghaensis
Planococcus donghaensis
Planococcus donghaensis strain DSM 22276
DNA section
IS Length : 1597 bp

Ends


IR Length : 28/33

IRL : GGCTATGTTAaataactctgttgttttttaagtactcattgaatttttaG
IRR : GGCTATGTTAtcgaactctgttgattttgaagtcaatcaaagggacttcc

Insertion site


Left flankDirect repeatRight flankDR Length
TGTGGTGTTTTTttctaattAAAACACATCCACAA8

DNA sequence

GGCTATGTTAAATAACTCTGTTGTTTTTTAAGTACTCATTGAATTTTTAGAACATTTGTTCTAAAAATGAGTATAAAAAGATGGAAGTGGGTGAAAGACA
TGGCATTGAAAGAAGTTATGCAGGAAGTCAAAAAACTATCGAATAAAGATATGCATCGGCTAATACAATTCTTGACCCAGTCTGTCACACCGCTTTCACC
GCAAGAGCCTTTATTTGAGGAGATTCGAGACCTAAAACACAAGGGCGGCTATACCTGTCCGCACTGCCAGTCCAATCTATCTGTCCGATTCGGTAAGTAT
GTTGTAAAAGTAGGTCTAAAGAAAATGAACCGCCAACGCTACCGATGCAAAGATTGTTTAAAGACCTTCACTGATGTCACCAATACCCCGCTCTATCGCA
CTCATAAGCCTGATAAATGGTTCGACTTCGTTCGATGCATGATTGATGGCGAGACGCTTCGCAAAGCAGCGGAGAAACTCGATGTCCACCATGTCACTTT
GTTCTACTGGCGCCATAAGCTTCTTTCCGCTCTAGAACAGATGGATTTCGAGAAGTTTGCAGGAATTGTTGAAATGGATGAGACCTATTTTCTGTACTCT
GAAAAGGGCAAGCGCGGAATTCAAGGACGGAAACCTCGTAAGCGGGGAGGTTCTTCGCAATTCCGCGGTATTAGCCATGAACAGATATGCGTACTCGTAG
CCAGAGACCGTCAAAAATCTACGTATTCACGGGTTATCGGTGAAGGACGTATTCTGAAGACTCGGCTTCACCAGGCGATTGGCGCTAAGCTGACTTCCGA
AAACGTTCTATGCACAGATGCGTGGCGAGCTTTCAAAACTTATGCCAAAGAAAAAGGAATGAACCACTATGCATTTAAATCAGATGGTAAGGAACGGGTT
AAAGGACTCTATCATATTCAAAATGTGAACAGTTACCACGGAAGGCTCAAGAACTGGATGAAACGTTTCAATGGTGTGGCGACGAAATACCTCGACCATT
ATTTGAGCTGGTTTCAGTTTCTAGATGCCATAAAACATCGAAATAATTCAGGGACAGTATCTAAGATGATGATTGAGAGCTGCTTATTTCCAGTTACTGA
AACTTATCAGGCACTCCGTACGTACCAATATAAAATATAGATGTTGAGGGGGAATCCGTTTGAAAAGAAAACACTCATATTTACTTATCTCTTTTTTGGT
TGCTTTGTTCTTTATGGCAGGTTGTTCAGTAGAAAATGCCGATACGTCATCCGCTGACTGGGCCTATTCATTCGTTGTATGGGATGATTATATTTACCAA
ATAGGCAATGAATATGTGCAAGAAGTAGATGAAGAGATTGGACAAGTCACGCTTTATTCTGATATGGAAGGTTCCTATGCGGGAAATTTCTCCAATGAAT
ATGAAAAAGGGACAAAGTATTTTTCAATAACAGGAATTAGTACGGAAGAAGCAATTGCCATTAAAGAAAAAGATGGCCAATATCGAAAAGCCATCAGAGA
CGGGAAATATGCAGGCAGGTAATTTATAGAGGGGGCTTCTTAAATTTGGAAGTCCCTTTGATTGACTTCAAAATCAACAGAGTTCGATAACATAGCC
Protein section
ORF number : 2

 

ORF 1
LengthBeginEndStrandFusion ORF
1041 bp346 aa1001140+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MALKEVMQEVKKLSNKDMHRLIQFLTQSVTPLSPQEPLFEEIRDLKHKGGYTCPHCQSNLSVRFGKYVVKVGLKKMNRQRYRCKDCLKTFTDVTNTPLYR
THKPDKWFDFVRCMIDGETLRKAAEKLDVHHVTLFYWRHKLLSALEQMDFEKFAGIVEMDETYFLYSEKGKRGIQGRKPRKRGGSSQFRGISHEQICVLV
ARDRQKSTYSRVIGEGRILKTRLHQAIGAKLTSENVLCTDAWRAFKTYAKEKGMNHYAFKSDGKERVKGLYHIQNVNSYHGRLKNWMKRFNGVATKYLDH
YLSWFQFLDAIKHRNNSGTVSKMMIESCLFPVTETYQALRTYQYKI

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
309 bp102 aa12141522+No
ORF function : Passenger Gene
Annotation : Hypothetical proteinDescription :

ORF sequence :

MAGCSVENADTSSADWAYSFVVWDDYIYQIGNEYVQEVDEEIGQVTLYSDMEGSYAGNFSNEYEKGTKYFSITGISTEEAIAIKEKDGQYRKAIRDGKYA
GR

 

Blast result :
Comments
ISPdo1 is 85% (transposase) aa similar to ISBce20.
References
1] Thomas Jové (2016) Direct submission.
2] See-Too,W.S. (2016) Direct GenBank submission.