ISDesu2

  • Family IS1595
  • Group IS1595
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
CP015080 ND Desulfuromonas sp.
Desulfuromonas sp. DDH964
DNA section
IS Length : 1059 bp

Ends


IR Length : 21/24

IRL : CCTGATTAGccctaattctcagctatgacacattctgtcgcacaggaagc
IRR : CCTGATTaggtccaattctcagctcggcgaagccaggcctcgggccgctt

Insertion site


Left flankDirect repeatRight flankDR Length
CGGAGTATTGCAttagaaaaAGGGCCGGTCCG8
GTAGTTTTTTCAAGGTTTTTTGCCGATTTCGG8
AGCGGAACCGCATTTTCTTTTGAAAGTGAGCT8
GGCGGAGGGGCAAAAAGAATTGGTGGTTTGGT8
AAATGTGCAACATTTAATTTTATGGCGGGTGC8
GTCTTGTTCTCAATAGTTTTTGTCGGGCAGCG8
AACGAGGGTGTAAAAAAGATTGTGTAAATGGC8
GTAACAACAGCATTCCCTTTTGACCGGGCGAT8
AAATCGAAGGCATTATGATTTGTGATCGCAAA8
TCACATTATCCATAGAAATTTGAAAGGCAGGT8
CGCCTGCCAGCAAAAATAATTGCCGCCCTTTT8
CATCAGCGGATATTTTTTTATGACGACTCCCA8

DNA sequence

CCTGATTAGCCCTAATTCTCAGCTATGACACATTCTGTCGCACAGGAAGCATAGAGTTTGGCCATGGAACCCATGAAAAACAAGGAGGTTAGCACCCATG
GCCATCAATCGTATCCAGTTTCAACCGGGGCTGAGCTTGGCTGATTTTCTCAAAGACTACGGTACGGAAACCCAATGCGAGGCGATCCTTGAGCGCTCGC
GCTGGCCCCAAGGATTTGTCTGCCCAGCATGCAGTGCAAGCCGCGCGGTCCAGTTCCGGCGAGGACAGTCGAAAATCTTCCAGTGCAGTCGCTGTCGAAA
ACAGATCTCTCTGATTTCCGGAACGATTTTTCATGGGAGCAATCTACCGCTGACCCAGTGGTTTCTTGCCCTCTACTTTATGACACAAGGCAAGTCCGGC
CTGTCGATGCTGGAGATGAGACGTATGCTGGGCTTGAGCTACAAGGCGGCTTGGCGACTCAAGCACAAGCTCATGCAGGCGATGTTCGAACGCGAAGAGA
CAACGGTTCTGGGTCAGCGAGTCGAGATCGACGATGCCTACTTGGGCGGAGAACGCTCCGGCGGGAAAGTCGGTCGCGGTTCGGAGAACAAAGTTCCCTT
CATTGCGGCGGTGGAAACGAGTCATGACGGCCATCCGCTGCGAGCGGTTTTTAGCCGGGTGACGACCTTCAGCAGCCATGACGTTGATCAATGGGCCAAG
AATCATTTGGCACCGACGGCGCTGGTCGTTTCTGATGGCCTGAATTGCTTCCGCGCGGTCACCAAGACTGGGTGCTACCATCAGCGAGAGGTGGTTGGTG
ATCAACGCAGAAGTACCGACATGGGCTGCTTCCACTGGATCAACACCATCCTGGGCAATCTTAAGACGGCCATGGCCGGAACGTATCATGCGTTTGACTT
CGACAAATATGCGCATCGCTATCTGGCCGAGTTTCAGTACCGGTTCAACCGGCGGTTCGATCTGCGCAGCATGCTGCCAAGACTGCTTTTCGCCTGTGTC
TCAATCGGCAAGCGGCCCGAGGCCTGGCTTCGCCGAGCTGAGAATTGGACCTAATCAGG
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
957 bp318 aa981054+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MAINRIQFQPGLSLADFLKDYGTETQCEAILERSRWPQGFVCPACSASRAVQFRRGQSKIFQCSRCRKQISLISGTIFHGSNLPLTQWFLALYFMTQGKS
GLSMLEMRRMLGLSYKAAWRLKHKLMQAMFEREETTVLGQRVEIDDAYLGGERSGGKVGRGSENKVPFIAAVETSHDGHPLRAVFSRVTTFSSHDVDQWA
KNHLAPTALVVSDGLNCFRAVTKTGCYHQREVVGDQRRSTDMGCFHWINTILGNLKTAMAGTYHAFDFDKYAHRYLAEFQYRFNRRFDLRSMLPRLLFAC
VSIGKRPEAWLRRAENWT

 

Blast result :
Comments
ISDesu2 is 79% aa similar to ISGlo2.
References
1] Thomas Jové (2016) Direct submission.
2] Badalamenti,J.P. and Bond,D.R. (2016) Direct GenBank submission.