ISRsp21

  • Family IS1595
  • Group ISSod11
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
FNAP01000012 ND Rhodospira trueperi
Rhodospira trueperi ATCC 700224
DNA section
IS Length : 1033 bp

Ends


IR Length : 20/23

IRL : GAGGCTTATCCCTTTGAATCCGGGACCACATCATGTGGTGACAGGTGACC
IRR : AAGGCTTATCCCTTTGTTTCCGGCGCGATCAACATATCGTAGGTGATGGG

Insertion site


Left flankDirect repeatRight flankDR Length
TGATGCGAAATCTGGATGATCCGTAGCC8

DNA sequence

GAGGCTTATCCCTTTGAATCCGGGACCACATCATGTGGTGACAGGTGACCCGAAAAGGCGTAGAACATAAAGTGAACAAATGCCGTTTCCGGAGCCCGAT
CATGAGCGCGTTTCCCCGATCCCTGCTCGAATTCCAACGCCAGTTCTCTGACGAAGCCGCCTGCGCGGCGTACCTCGCGAGACAACGCTGGCCCGAGGGA
TTCGTCTGTCCGGTGTGCGGCGGCAAACGCGGCTGGGCGTTGGAAACCAAGGCGTGGACCACGGAGTGCGCCGACTGCGGCTGCCAGACTTCGGTCACGG
CCGGGACGGTCATGCATCGCAGCAAGCTGCCCCTGACGGTGTGGTTCTGGGCGGCGTATCTGATGGCGACCCACTCCAACGGCATCTCGGCCACCCAGAT
CCGGTCGCAACTGGGGCTGGGCTCCTACAAGACCGCCTGGCTGCTGTGCGCCAAGCTGCGCAGCGCCATGGTCAACCCGGAGCGCACGCCGCTGTCCGGC
CTCGTGGAGATGGATGAGACCACCATCCCCTTCAGAACACACGAGGATCCGCCCGCCAGCGGACAGGGGCGCAGCCACCAGGGCAAGATGTTGGTCGCCG
GGGCCGTCGAGATCATGGACGGAGGGCCGGGCCGCATCCGCCTGCGCGTCATCCCCGACTTCTCCGGCGAGACCCTGAAGGGTGTCGTCAAAGAGACCGT
CGCGTCCGGTGCCACGCTCAAGACCGACGGATGGGCCGGATACAGCGCCAGCGATGACGTCGCCCACGACCCCCATGTCATCGGCCCGATGGCCGCACAT
ATCGTGCTCCCCTGGGTCCACCGCGTGTTCTCCAACCTGAAAACCTGGGCGCTCGGCGTCTACCACGGTCTGCGGCGGAAGCATCTGCAATCCTACCTCG
ACGAATTCGTCTTCCGGTTCAACCGGCGCCGGACCCGGCACGCAGCCTTTCGATCCCTCCTGGGCATCGTCACCACCAAAGGACCCATCACCTACGATAT
GTTGATCGCGCCGGAAACAAAGGGATAAGCCTT
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
927 bp308 aa1021028+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MSAFPRSLLEFQRQFSDEAACAAYLARQRWPEGFVCPVCGGKRGWALETKAWTTECADCGCQTSVTAGTVMHRSKLPLTVWFWAAYLMATHSNGISATQI
RSQLGLGSYKTAWLLCAKLRSAMVNPERTPLSGLVEMDETTIPFRTHEDPPASGQGRSHQGKMLVAGAVEIMDGGPGRIRLRVIPDFSGETLKGVVKETV
ASGATLKTDGWAGYSASDDVAHDPHVIGPMAAHIVLPWVHRVFSNLKTWALGVYHGLRRKHLQSYLDEFVFRFNRRRTRHAAFRSLLGIVTTKGPITYDM
LIAPETKG

 

Blast result :
Comments
ISRsp21 is 82% aa similar to ISApr2.
References
1] Thomas Jové (2016) Direct submission.
2] Varghese,N. and Submissions,S. (2016) Direct GenBank submission.