ISRhtr1

  • Family IS1595
  • Group ISSod11
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
FO082820 ND Rhizobium sp.
Rhizobium sp.
Rhizobium sp. NT-26
DNA section
IS Length : 2124 bp

Ends


IR Length : 33/39

IRL : ACGGCTTATCCCGCTAGCTCCGGTTTAACCATATCTTGAGGTCCCGGCGC
IRR : ACGGCTTATCCCTTTAGCTCCGGTCCTACCATATATTGATGATCGATAAA

Insertion site


Left flankDirect repeatRight flankDR Length
CTGATGGGATGACGTTTTGTCCGCTGGC8

DNA sequence

ACGGCTTATCCCGCTAGCTCCGGTTTAACCATATCTTGAGGTCCCGGCGCGGGAGTCTCGCCAAGGCACACTCACTGGTTTAATTGGGGCGAATGGCCCA
TCAGTCTGTCTTCAGATGGCGCTACGACCGCCCGCTTTCGCTGGAGCAGTTTCAACTGCGTTTTCCTGATGACTACGCCTGCGCGGCCTATCTGGCGAAG
AAGCGATGGCCCGACGGCTTCGTCTGCCCGCACTGTGGTTCGACGAAGGGTTGGAAGCTGCGGTCGAAGCCGTGGGTCTGGGAGTGCGGTGGAGAGCAGG
CCGACGAGGACGGCGAACTGACCCCGTGCCGCAAACAGACGTCCGTCATCGCTGGCACGATCATGCACAAGACGCACCTGCCGCTGCGGCAGTGGTTCCT
GGCAGCGCACCTGGTGACGACGCACTCGAACGGCATCTCAGCCCTTCAGCTCCAGGCCAAGCTGGGCATCGGCTCCTACAAGACCGCATGGCTTCTCCTG
CACAAGCTACGTCGCGCCATGGTCAATCCCGACCGAGAGAAGTTGGGCGGCTACGAAGAGACCGTCGAGATCGACGAGACGAGCATTCCCTTCCGGACAA
AGGACGAGCCCGTCGGCGGCGGACAGGGCCGCAGCCCCATCGGCAAGCTCAACATCATCGGGGCGGTGGAATGGCGCGACGAAGGCAGGTCTGGCCGCAT
CCGCCTTGAACCTATCCGCACCAACGGCAGGGAATCCCTGCATCCATTCGTGTTGCGCAACACGAATCCCCACACGACGATCTTCACCGACGGCAACCAG
GCCTATCAGGGTATTCCCGACCGCAATCACGCCTCGAAAGTCGTGGGGAAACTGCCCGCGCATCTTTGGTTCAAACGCATACACCGCGTCTTCTCGCTGA
TGAAGCGGTGGATGATGGGTGTATATCACGGCGTCCGCCGACGTCACCTCAACATCTACCTCCAGGAGTTCGTCTTCCGCTGGAACCGTCGACGGCAATA
CCGCGCCGCATTCGACAGCCTCGTCGCCATCGGCAACGAGGTCGGCCATGCCAGCCTCCGCGACATCGTCGGCAGGCCGCCGGTCCTCAAGACGCTCATG
GATCAAGTGCGTGATGGGATCGAGCTGGATCGCCGCCAGGCGTACCTGGAGGCTATCGCCAAGGGTGTACCCAGTGTCTTTGCGGAGAGACTGCTCGACC
CCGACTACGTTGCGCCAGAACCACGCGTCTATCGGCGAAATGTACCGCCGCGACCGATCTTAGCCAAATCACGCTCGGCTTTTGTATACGCTACTCACTG
ACAACGCATTCAAAGCCCAGGATTAGCGCCACCGCTATACGTATCTTCGTTGTCTTCATCATCATCGTTGTCATAGTCAGCAGCAAGCTCGGCAGGCGTA
TATGCGTCCTTCTGCCGTGCGTCTCTTATTGCCGCGATTTCAACCATGCCGTCGCGTGCGCGAATCGTGAGGACCAAAGGCGGCATGCTCACCTTGCGCG
TACCTTCAAGAACACCTTTCTCGGTCATTTGCGGGAAGGACGAAAGAAGGTCCTTCTGCCTCTCCAGACGCTCAATCAGGCTTCTGGCGGCTGCGGGGTT
CACCTCCGAAAGTTCTACAACCTTGTTGAGAAACCAGCGTTCCGCGCTCTTCGATAAACGGACAGGAGGCATCAACCGGCCCGCTGACTACGTCGATACT
CGGCTGCATCAACGATAGTTCGAGCCTTATCAAGCACATCTTCGAGATCAACACTTTCGCCGCGATCCAGCTCAGCGATGCCTTGGGCATCCCGAAGAAC
TTCGGCTCCTTCACCTGCCAAATATTGGCTGAGGGCTTTCTGCATCACCCAAGTCCGATCCCGATCAAGAAGGCCTGCGATTTCATCGAACTTGGCAACC
ACAGGAGATGGTAGCCGCAGGGAGACCTGCGTTTTTTCGTTGTTCAACATGATGGAGGCTCCGTATTTCACTGCATTACAGCGTAACCCAATAACCATCA
AAGTCAATTGCTATCGGCCTTAACGACCCCGACAGAATCGCATAATCCTATTTTGATCAGTAATTTACGAGAATTTTATCGATCATCAATATATGGTAGG
ACCGGAGCTAAAGGGATAAGCCGT
Protein section
ORF number : 3

 

ORF 1
LengthBeginEndStrandFusion ORF
1209 bp402 aa931301+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MAHQSVFRWRYDRPLSLEQFQLRFPDDYACAAYLAKKRWPDGFVCPHCGSTKGWKLRSKPWVWECGGEQADEDGELTPCRKQTSVIAGTIMHKTHLPLRQ
WFLAAHLVTTHSNGISALQLQAKLGIGSYKTAWLLLHKLRRAMVNPDREKLGGYEETVEIDETSIPFRTKDEPVGGGQGRSPIGKLNIIGAVEWRDEGRS
GRIRLEPIRTNGRESLHPFVLRNTNPHTTIFTDGNQAYQGIPDRNHASKVVGKLPAHLWFKRIHRVFSLMKRWMMGVYHGVRRRHLNIYLQEFVFRWNRR
RQYRAAFDSLVAIGNEVGHASLRDIVGRPPVLKTLMDQVRDGIELDRRQAYLEAIAKGVPSVFAERLLDPDYVAPEPRVYRRNVPPRPILAKSRSAFVYA
TH

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
363 bp120 aa16721310-No
ORF function : Passenger Gene
Annotation : Hypothetical proteinDescription :

ORF sequence :

MPPVRLSKSAERWFLNKVVELSEVNPAAARSLIERLERQKDLLSSFPQMTEKGVLEGTRKVSMPPLVLTIRARDGMVEIAAIRDARQKDAYTPAELAADY
DNDDDEDNEDTYSGGANPGL

 

Blast result :
ORF 3
LengthBeginEndStrandFusion ORF
132 bp43 aa17831914+No
ORF function : Passenger Gene
Annotation : Hypothetical proteinDescription :

ORF sequence :

MGIPKNFGSFTCQILAEGFLHHPSPIPIKKACDFIELGNHRRW

 

Blast result :
Comments
ISRhtr1 is 66% (ORF1 : the transposase) aa similar to ISApr2.
References
1] Thomas Jové (2016) Direct submission.
2] Andres,J., Arsene-Ploetze,F., Barbe,V., Brochier-Armanet,C., Cleiss-Arnold,J., Coppee,J.Y., Dillies,M.A., Geist,L., Joublin,A., Koechler,S., Lassalle,F., Marchal,M., Medigue,C., Muller,D., Nesme,X., Plewniak,F., Proux,C., Ramirez-Bahena,M.H., Schenowitz,C., Sismeiro,O., Vallenet,D., Santini,J.M. and Bertin,P.N. (2013) Genome Biol Evol 5 (5), 934-953.