ISJsp3

  • Family IS21
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
CP000269 ND Janthinobacterium sp
Janthinobacterium sp Marseille
DNA section
IS Length : 2615 bp

Ends


IR Length : 23/25

IRL : TGTTGGCgccgaccgaaaactgagccacttatgaggggtgtgccgatcta
IRR : TGTCCGCgccgatccaaatctgagccaccgtgccgatccaatattgagcc

Insertion site


Left flankDirect repeatRight flankDR Length
cgtcgtaagtttctcggggt0

DNA sequence

TGTTGGCGCCGACCGAAAACTGAGCCACTTATGAGGGGTGTGCCGATCTAAAACTGAGCCAGGTGTTCAACCTACTCTGCTGCTTTTTGATGCAGCGGGG
TTCGAGGAGTGATCACCATGGACATGATCGGCAGAATCCGGCGGCTGCACAGCCGAGGCAAGAAGTCAGAGCGGGAGATCTCGCGGATGACGGGGCTATC
GCGCAACACGATAGCCAAGTGGCTCAAGGCGCCATTGGATGGCGAGCCCAAGTACCGGCGAATCGAGCAGCCGGGCAAGTTGACGGCCTTCCACGAGGTT
CTCAGGCAGGCGCTCAAGGCCGATGCCTATCGGGCCAAGCACGAGCGCCGCACGGCACGGGCGCTGTACAGCGAACTCAAGTCGGCAGGTTACGAAGGCG
GCTACAGCCGCGTGACGGACTTCATCCGCCAGTGGCGCCAAGGCGAGGGGCAAGCGGTAGCGACGCGAGCCTTCGTGCCCTTGTCGTTCGAGCTGGGCGA
GGCATTCCAGTTCGACTGGAGCGAAGAAGGCCTGGTGGTGGGCGGCATTTACTACCGGCTGCAGGTCTCGCACATGAAGCTGTGTGCCAGCCGTGCGTTC
TGGCTGGTGGCGTATCCCAGTCAGGGACACGAGATGCTGTTCGATGCGCACACGCGCAGCTTTGCGGCGCTGGGTGGGGTGGCCAGGCGCGGCATCTACG
ACAACATGAAGACGGCGGTGGACCAGGTCAAGAAGGGCAAGGGCCGAGTGGTCAACGCACGCTTTGCGGTGATGTGCGCGCACTACCTGTTCGACGCCGA
CTTCTGCAACGTGGCCAGTGGCTGGGAGAAGGGGGTCGTCGAGAAGAACGTGCAAGATAGCAGGCGGCGAATCTGGATTGATGCGGCCAAGCAGCGCTTT
GGCTCCTTTGCAGAACTCAACGCCTGGCTGGGCGAGCGCTGTCGCAGCCTGTGGGCGGAGGTTCGCCACCCAGAGCATTCGCAGTTCAGTGTGGCCGAGA
TGCTGGAGCATGAACGTGCCCATTTGATGTCAATGCCGCAGCCCTTTGACGGCTATGTGGAGCGCCCGGCGAGGGTGACCAGCACCTGCTTGGTCTCGGT
CGCACGCAACCGTTACTCGGTGCCTTGCGAGCTGGCCGGGCAGATGGTCAGCACCCGGCTGTACCCGACGCGGGTGGTCGTGGTGGCCAACGATGAGGTG
GTGGCGCAGCATGAGCGATTCAGTGACCGTGGACAGACCCGCTATGACTGGCAGCACTACATCCCGCTGGTGCAAAGAAAGCCCGGTGCGCTGCGCAATG
GCGCACCGTTTGCCGACCTCCCCCCGGCCTTGCAGCAGTTGCGCAGAGGGCTGCTACGCCAGGCCGGTGGCGACCGTGTCATGGCGCAGGTACTGGCCAT
TGTGAGCACAGCTGGCCTGGATGCGGTGCTGGTGGCAGTTGAATTGGCGCTGGAGAGCGCGCCACCGTCTGGCAAGGTCAGCGTCGAGCATGTGATCAAT
GTTCTGAGCAGGCTCAACCCTGCACCCACGCCTGAAGATGCACAGACCTGTTTGCAGGCGACAGTGGCCCCACTGGCCAACACGGCGCGCTACGACAGCT
TGCGCGGGCAAGGCGGCACGGAGGAGATCAACCATGCGTGATATCGCTGCAGAGCTCAAACAACTGCGCCTGCACGGCATGGCGGGCGCATGGTTGGACC
TGATCGAACAAGGGTCCAGTACGGGCTCAGAGGATGCACGGTGGTTGATTGAACACCTGCTGCAGGCCGAGGCCACAGACCGAGGCATGCGCTCGGTGAG
CCATCAGATGCATGCAGCCAAGTTCCCTGTGCATCGAGACCTGGCTGGGTTCGACTTCGCTGTGTCCCCCGTTGACAGCAAGCTGGTTCACACGCTGGCA
GAGACAGGCTTCACAGAAGTGGCGCACAACGTGGTGTTGGTGGGAGGGCCTGGCACCGGCAAGACCCACCTGGCCACAGCCATTGGCGTGTCCGGCATCA
CCAAGCATGGCAGGCGCGTGCGCTTTTACTCCACGGTGGATCTGGTCAACGCGCTGGAGCAAGAGAAGGCACAAGGCAAGGCCGGACGCATCGCGACGAG
CTTGTTGCGCCTGGACCTGGTGATCCTCGATGAGTTGGGCTACCTGCCGTTCAGCCAGGCAGGCGGTGCGCTGCTGTTCCACTTGCTCAGCCGGTTGTAC
GAGCACACCAGCGTGATGATCACGACGAATCTGGACTTCGCGGAATGGTCGCGTGTCTTTGGTGATGCCAAGATGACGACGGCGCTGCTGGACCGGCTCA
CACACCACTGCCACATCCTGGAGACGGGCAACGAGTCACACCGATTCCTGCACAGTTCCAGCACGGCCAAGAGGCGCATCAAGGCACGAGAGCAGTCTCG
GATGCAGGCTGCAGCAGAGGGCAAGGCCTGAAGCTCAAAGCGAAGGGGGAAGCCGCTGCGCGGCTTCCCCCTTGATGTTCAACCAAGCCGGCCGGAAAAC
TCAAAACCCAGGCCAGGCTCTACACTTATCCACAGCTGACCACCCTTTGGTCGGCTACCAGCCCTGGCTCAATATTGGATCGGCACGGTGGCTCAGATTT
GGATCGGCGCGGACA
Protein section
ORF number : 2

 

ORF 1
LengthBeginEndStrandFusion ORF
1524 bp507 aa1181641+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MDMIGRIRRLHSRGKKSEREISRMTGLSRNTIAKWLKAPLDGEPKYRRIEQPGKLTAFHEVLRQALKADAYRAKHERRTARALYSELKSAGYEGGYSRVT
DFIRQWRQGEGQAVATRAFVPLSFELGEAFQFDWSEEGLVVGGIYYRLQVSHMKLCASRAFWLVAYPSQGHEMLFDAHTRSFAALGGVARRGIYDNMKTA
VDQVKKGKGRVVNARFAVMCAHYLFDADFCNVASGWEKGVVEKNVQDSRRRIWIDAAKQRFGSFAELNAWLGERCRSLWAEVRHPEHSQFSVAEMLEHER
AHLMSMPQPFDGYVERPARVTSTCLVSVARNRYSVPCELAGQMVSTRLYPTRVVVVANDEVVAQHERFSDRGQTRYDWQHYIPLVQRKPGALRNGAPFAD
LPPALQQLRRGLLRQAGGDRVMAQVLAIVSTAGLDAVLVAVELALESAPPSGKVSVEHVINVLSRLNPAPTPEDAQTCLQATVAPLANTARYDSLRGQGG
TEEINHA

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
798 bp265 aa16342431+No
ORF function : Accessory Gene
AG : IS21 helper

ORF sequence :

MRDIAAELKQLRLHGMAGAWLDLIEQGSSTGSEDARWLIEHLLQAEATDRGMRSVSHQMHAAKFPVHRDLAGFDFAVSPVDSKLVHTLAETGFTEVAHNV
VLVGGPGTGKTHLATAIGVSGITKHGRRVRFYSTVDLVNALEQEKAQGKAGRIATSLLRLDLVILDELGYLPFSQAGGALLFHLLSRLYEHTSVMITTNL
DFAEWSRVFGDAKMTTALLDRLTHHCHILETGNESHRFLHSSSTAKRRIKAREQSRMQAAAEGKA

 

Blast result :
Comments
ISJsp3 is 90% (transposase) aa similar to ISAisp6 and 92% (IS21 helper) aa similar to ISCARN16.
References
1] Thomas Jové (2016) Direct submission.
2] Audic,S., Robert,C., Campagna,B., Parinello,H., Claverie,J.M., Raoult,D. and Drancourt,M. (2007) PLoS Genet. 3 (8), E138.