ISUnb1

  • Family IS1595
  • Group ISSod11
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
CP013118 ND bacterium L21-Spi-D4
bacterium L21-Spi-D4
DNA section
IS Length : 970 bp

Ends


IR Length : 21/25

IRL : TAGAGGTCAGTAGATAAATTCATATAATATATTATCTTTGATACCAATAA
IRR : TAGAGGTCAGTATTTAACTGCATATTAAATCTGCTTGCTTTACTTTATCA

Insertion site


Left flankDirect repeatRight flankDR Length
AAAACTATTATAAAATGATTTCTAAAGC8
CTGCATAAATTAGGTTTTTATGCCATAA8
CAATAGAAAATAATCAATATTCAATTTT8
TCTACAGGAAAACCATAAATCAGATATT8
CAAACACATTAAGAATTATTTCAGAGAA8
GAATGGTAAATAAAGCTATTTCATCCTC8

DNA sequence

TAGAGGTCAGTAGATAAATTCATATAATATATTATCTTTGATACCAATAAAATCAATGATTTAATGGAATTATTCAAAGGACAAAACCTCATAGAGTTTG
CTACACGCTTTAATTCGGATGAAAAGTGTATTGAATATTTAGCTCATATTAAATGGCAAGATGGATTTAGATGTGTTAAATGTGGTCATACCGGAAGTCA
AGTAAGAAAGAATCATTCAAGAACGTGTAATAAGTGTAATCATACTGAATCAGCAACAGCAAATACACTATTCCACAAAGTTAAATTTGGTGTTCAAAAG
GCTTTTTTTATTTGCTTTGAAATGGCAACTACAACCAAAAGTTTATCTGCAAGTTATGTTGGAGAACGCTTTGGGGTTACTGAGAAAACAGCTCGACTGT
TTATGCATAAAGTACGGGAAGCGATGAAGTCAAGCGGTAATAACCCAATGAGTGGAAATGTACATATTGATGAGTTTGTAATTGGTGGAAAGGAAGAGGG
AAAAGTTGGACGTAGTTACCATATTAAGAAAAAGAAGGTTATATGTGCTGTAGAGCTTACTGATGATGGTAAGGTTAAACGCATGTACTCGATGAAAATA
GACAACTACTCATCGAAAGAGCTAGAAAAAATGTTCGATGCGCATATTTCTCAACAGGCAAAGGTAACAACAGATCAATGGAAGGGCTACCGTCCACTCA
TGTCAAGCTATGATATAAGACAAATCGAGAGTGACAGAGGTTCCAACTTCAAGGCTTTGCACACAATGATTCATCAAGTTAAATCTTGGATAAGAACCAC
TTACTCATGGGTTAGCACTCACAATATCAACAGGTATCTTGACGAGTTTTGCTACCGACTTAATCGTTCTCAAATGAAAAAGAATATTTTCAATAATTTG
GTACGCAGGATGGTTATTGCTGATAAAGTAAAGCAAGCAGATTTAATATGCAGTTAAATACTGACCTCTA
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
894 bp297 aa64957+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MELFKGQNLIEFATRFNSDEKCIEYLAHIKWQDGFRCVKCGHTGSQVRKNHSRTCNKCNHTESATANTLFHKVKFGVQKAFFICFEMATTTKSLSASYVG
ERFGVTEKTARLFMHKVREAMKSSGNNPMSGNVHIDEFVIGGKEEGKVGRSYHIKKKKVICAVELTDDGKVKRMYSMKIDNYSSKELEKMFDAHISQQAK
VTTDQWKGYRPLMSSYDIRQIESDRGSNFKALHTMIHQVKSWIRTTYSWVSTHNINRYLDEFCYRLNRSQMKKNIFNNLVRRMVIADKVKQADLICS

 

Blast result :
Comments
ISUnb1 is 81% aa similar to ISEvi1.
References
1] ISfinder annotation (2016)
2] Spring,S., Bunk,B., Sproer,C. and Klenk,H.-P. (2015) Direct GenBank submission.