ISPman1

  • Family IS21
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
CP005961 ND Pseudomonas mandelii
Pseudomonas mandelii JR-1 plasmid
DNA section
IS Length : 2580 bp

Ends


IR Length : 24/27

IRL : TGTTGCCGCTGACCGAAAACTGACCCAGTAAAGGCTGTTCTGCCGACTGA
IRR : TGTTGGCGCTGATTGAAAACTGACCCACCCTGCCGATTGAAAATTGACCC

Insertion site


Left flankDirect repeatRight flankDR Length
GTCGGTTGCGAAACGAGTTC0

DNA sequence

TGTTGCCGCTGACCGAAAACTGACCCAGTAAAGGCTGTTCTGCCGACTGAAAACTGACCCAGGTGTTCAACTACTTCTGCTCACTTTCCGAGCAGGAGAA
CACAGGGTGATCAGCATGGAAATGTTGGGGAAAATTCGGAGGATGTACTTTCGCGACAAGCTGTCGCTGCACCAGATCGCCAAGCGTACCGGGCTGTCGA
GAAACACCATCCGAAAATGGGTCAGAGCACCCGAAGCCACTCAGCCGGCGTACCAGCGGGGCGCTACCTTCAACAAACTCAGTCCATTTCACGAGACGCT
GGAGCTGGCGCTCAAGGCCGATTCGTTTCGGGCAAAGCACAACCGCAGGAGTGCCAAAGCACTCTTCGAACAGATCAAGGCCGAGGGCTACGACGGCGGC
TACAGCCAGCTCACCGCCTTCATCCGTGCGTGGCGCGGCGAGCAAGGCAAGTCTTTACGGGCCTTTGTGCCGCTGACCTTTGCACTCGGGGAGGCCTTTC
AATTCGACTGGAGCGAAGAAGGTCTGCTGATCGGCGGCCTGTTCCGACGCATCCAGGTCTCCCATATGAAGCTGTGCGCCAGTCGCGCATTTTGGTTGGT
TGCGTATCCCAGCCAAGGCCACGAGATGTTGTTCGACGCCCATACCCGCTCGTTTGGCGCGTTAGGTGGGGTGCCGCGTCGCGGCATCTACGACAATATG
AAAACGGCTGTCGACAAGGTCAACAAAGGCAAAGGCCGCACAGTCAATGCCCGGTTTGCCGTCATGTGTGCCCACTACCTATTCGATCCGGACTTCTGCA
ACGTGGCCTCCGGCTGGGAAAAAGGCATCGTTGAAAAGAACGTTCAAGACAGCCGACGGCGCATCTGGCTCGATGCTCAAAACTGCATGTTCCATACCTT
CGAGGAATTGAATGCCTGGCTCGGCCAACGCTGCCGTGCGCTCTGGGACGAACTGGTGCACCCGCAGTACAACGGGCTGACAGTGGCGGACGTCCTGGAG
CTGGAACGCGCCGAATTGATGCCGATGCCGACTGCCTTTGATGGCTACGTCGAGCGCACCGTACGGGTCTCCAGCACCTGCCTGATCAGCGTGGCGCGAA
ATCGCTACTCGGTGCCGTGTGAGCGGGTCGGTCAGTGGGTCAGCAGCCGTTTGTATCCCACACGGGTGGTGGTCATCGCCGATGAAACGATGATCGCCAG
CCACGAGCGTCTGTTTGATCGAGATCAGGTCAGTTTTGACTGGCAGCATTACATCCCACTCATCGAACGCAAACCCGGTGCGCTGCGCAATGGCGCGCCG
TTTGCCGATCTGCCCAAGCCGTTACAGCTTCTCAAGCGGGGCCTGAGACGTCACAGCAACGGTGATCGAATCATGACGCAGGTACTGGCTGCTGTGCCCA
TCGCCGGTCTCGACCCGGTGCTCGTGGCGGTAGAACTGGTGCTTGAGTCGGGAAGCCTGAGCGCCGATCACATCCTGAATGTTCTAGCTCGACTGACCTC
TACTGCACCACCTCCTTCCGCCGAAACCAGCCTGCAACTCAAGGTAGCGCCTGTCGCCAATACAGCGCGCTACGACCGGCTCCGTACCACCGATGAGGAG
AATCGCAATGCGTGACCTAATGGCGGAACTCAAAGAACTGCGTCTGCATGGCATGGCCAGCGCCTGGGAGGAACTAGCCTCGCAAGGAGAAGCTTCGACG
GCATCCTCGAAATGGCTGCTCGAACATCTGCTTCAACAAGAACATGCAGATCGAGCAGTGCGCTCAGTGAATCATCAGATGAACATGGCCAAACTGCCCA
TGCATCGTGATTTGGCCGGCTTCGACTTCAGCGCTTCCAGCGCAGATGCCCGCCTGATCAGGGATCTGTCCAACCTGGAGTTCACCGATACCGCGCAGAA
TGTCGTGTTCATCGGCGGGCCTGGAACAGGCAAAACACACCTCGCCACCGCCTTGGCCGTTTCCGGGATCACGACGCATCACAAACGCGTGCGCTTCTAC
TCCACGGTGGATCTGGTCAATCTGCTGGAGCGCGAAAAGTACGACGGCAAGACGGGCCGCATCGCTCAAGGGCTGCTACGAACAGACCTGGTGATACTCG
ATGAACTGGGGTATTTGCCCTTCAGCCAGAGCGGTGGTGCCCTGTTATTTCATTTGCTGTCCAAGCTGTACGAGCACACCAGCGTGGTGATCACCACCAA
CCTCAGCTTCTCGGAATGGTCGAGCGTGTTTGGTGACGCCAAGATGACAACGGCGTTGCTGGATCGGCTGACACACCACTGCCACATCGTCGAAACGGGC
AACGAGTCCTACCGCCTGCAACACAGCAGCTTGGTCGCCCAGACCAAGATCAAATCACGTGAACGAAAGCGCAAAGACAATGATGGTGCCGAGGACGATG
AGCTGTTTTGATCCGCACCGAAAATACCCTGCCGCATGCCCACATGCGGTGGGGCTCGATGACCGTTCAACCGGGACACTACTGCTAAGCTTATTCACAA
TTGCTGGGACAAAAAACAGCAATCCGCCCTGGGTCAATTTTCAATCGGCAGGGTGGGTCAGTTTTCAATCAGCGCCAACA
Protein section
ORF number : 2

 

ORF 1
LengthBeginEndStrandFusion ORF
1509 bp502 aa1071615+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MISMEMLGKIRRMYFRDKLSLHQIAKRTGLSRNTIRKWVRAPEATQPAYQRGATFNKLSPFHETLELALKADSFRAKHNRRSAKALFEQIKAEGYDGGYS
QLTAFIRAWRGEQGKSLRAFVPLTFALGEAFQFDWSEEGLLIGGLFRRIQVSHMKLCASRAFWLVAYPSQGHEMLFDAHTRSFGALGGVPRRGIYDNMKT
AVDKVNKGKGRTVNARFAVMCAHYLFDPDFCNVASGWEKGIVEKNVQDSRRRIWLDAQNCMFHTFEELNAWLGQRCRALWDELVHPQYNGLTVADVLELE
RAELMPMPTAFDGYVERTVRVSSTCLISVARNRYSVPCERVGQWVSSRLYPTRVVVIADETMIASHERLFDRDQVSFDWQHYIPLIERKPGALRNGAPFA
DLPKPLQLLKRGLRRHSNGDRIMTQVLAAVPIAGLDPVLVAVELVLESGSLSADHILNVLARLTSTAPPPSAETSLQLKVAPVANTARYDRLRTTDEENR
NA

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
804 bp267 aa16082411+No
ORF function : Accessory Gene
AG : IS21 helper

ORF sequence :

MRDLMAELKELRLHGMASAWEELASQGEASTASSKWLLEHLLQQEHADRAVRSVNHQMNMAKLPMHRDLAGFDFSASSADARLIRDLSNLEFTDTAQNVV
FIGGPGTGKTHLATALAVSGITTHHKRVRFYSTVDLVNLLEREKYDGKTGRIAQGLLRTDLVILDELGYLPFSQSGGALLFHLLSKLYEHTSVVITTNLS
FSEWSSVFGDAKMTTALLDRLTHHCHIVETGNESYRLQHSSLVAQTKIKSRERKRKDNDGAEDDELF*

 

Blast result :
Comments
ISPman1 is 98% (transposase) and 95% (IS21 helper) aa similar to ISPsy20.
References
1] Thomas Jové (2016) Direct submission
2] Jang SH, Kim J, Kim J, Hong S, Lee C. (2012) J Bacteriol. Jun;194(12):3263.