ISFlsp4

  • Family IS1595
  • Group ISSod11
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
LVEP01000038 ND Flavobacterium sp.
Flavobacterium sp. LPB0076
DNA section
IS Length : 956 bp

Ends


IR Length : 23/28

IRL : TAGAGGTGTAAAGATAAATTCTTATCTTTCGTGAAAGAATTTTATTATGG
IRR : TAGAGGTGTAAAGTTATGTACTTATTTTAATTATTTGTAATCCAATGTGT

Insertion site


Left flankDirect repeatRight flankDR Length
TTAAGTAAAAG/ACCTTTTATTTTAAAAGA8

DNA sequence

TAGAGGTGTAAAGATAAATTCTTATCTTTCGTGAAAGAATTTTATTATGGAATCATTCAAAGGAGAAAGTATTATCGATTTTTTTGACACTTTCAAAACA
GATTTAACTTGTTTAGAATATTTAGCTTCAATAAAATGGAAAGATGGTTTTAAATGTTCGAAATGTAATCATAAGAAGTTTACTATTCGAAAGTTAAATT
TTGCAAGAGATTGCAATTTATGTCATCATGTTGAAAGTCCAACTGCAAATACTATTTTTCATAAAGTAAAATTTGGAACTAGAAAAGCTTTTGGGATTGT
TTTTGAGATGAGTGCAACCACCAAAAGTTTGTCTTCTTCTCAAATGGCAAAACGGTATTCTATAAGCCGACCAACGGCATGGTTGTTTATGCACAAAGTG
AGATTAGCCATGAAAAGTAGTGCGTTAAATCCGATTGTTGGAACTGTTTATGTTGATGAATTTGTATATGGTGGAAAAGAAGATTTAAAACAAGGAAGAA
GTAATGATAGCAAGAAAAAGAAGATAGTAGCTGCTGTTGAAATTGATGACAAAGGCGGGGTGAAAAGAGCTTATTTTAAAAGAATTGACAACTATTCTTC
TAGTGAACTTGGTAAAATTTTTGAAAGCCACATTTCAACACAAGCAAATATAAAAACTGATCAATGGACAGGCTATAAACCATTAAAGAATGAATACAAC
ATTGAACAAATTAAGAGTAATACTTCTGATTTTTTTCAAATGAACACTATTATTCATCAAGTAAAATCATGGTTAAGAAGTATTTATTCTTGGATGCACG
AACAAAATATAGAAAGGTATTTAGACGAATATAGTTATAGATTAAATAGGTCAATATACAAGGAAACTATTTTTGACAACCTAATTATTAAGATGATGAA
GCATAAACACATTGGATTACAAATAATTAAAATAAGTACATAACTTTACACCTCTA
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
897 bp298 aa47943+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MESFKGESIIDFFDTFKTDLTCLEYLASIKWKDGFKCSKCNHKKFTIRKLNFARDCNLCHHVESPTANTIFHKVKFGTRKAFGIVFEMSATTKSLSSSQM
AKRYSISRPTAWLFMHKVRLAMKSSALNPIVGTVYVDEFVYGGKEDLKQGRSNDSKKKKIVAAVEIDDKGGVKRAYFKRIDNYSSSELGKIFESHISTQA
NIKTDQWTGYKPLKNEYNIEQIKSNTSDFFQMNTIIHQVKSWLRSIYSWMHEQNIERYLDEYSYRLNRSIYKETIFDNLIIKMMKHKHIGLQIIKIST

 

Blast result :
Comments
ISFlsp4 is 83% aa similar to ISFbr1.
References
1] ISfinder annotation (2016)
2] Shin,S.-K., Choi,S. and Yi,H. (2016) Direct GenBank submission.