ISLisp1

  • Family IS21
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
ALKN01000051 ND Limnohabitans sp.
Limnohabitans sp.
Limnohabitans sp. Rim28
DNA section
IS Length : 2513 bp

Ends


IR Length : 24/29

IRL : TGTTGaatcacaaccaaaactgagccagtttcggagctttacacgTTGAA
IRR : TGTTGattcatcagccaaactgagccagtgttcacgttgaatattgagcc

Insertion site


Left flankDirect repeatRight flankDR Length
aggtccggaagccccagggc0

DNA sequence

TGTTGaatcacaaccaaaactgagccagtttcggagctttacacgTTGAAatttgagccaccccacaagctaccctgcttattttttgtgcagggtggca
ggaGTGATCAACGTGAGTACATTGAGCAAATTACGTCGTCTTGTTTTAAGAGACAACGTGTCCATTCGCGAGGCTAGCCGCCAGCTTGGAATTTCCCGCA
ATACGGCCAAGAAGTGGCTGGAGCAATCCGAGATGGTGGAGCCCCGCTATCCCAAACGGGCGTCAGGACCAGGCATATTGGGTCCCTACGAGGAGGTGCT
TACGCAGTGGCTCAAGTCCGACAGCCACCGCAACAAACGTGAGCGCCGAGGCACCAAGGCGCTGTTTGAGGGGCTGAGGGCGCTGGGTTACCCGGGCAGC
CGGGGCCCGGTTTACACCTTTGCCCTGCGTTGGCGCAAAGAGCAGGACTTGGCGGCCAAGGGCCAAGGTTATGTGCCCATGCACTTTGACATGGGCGAAG
CCTTCCAGTTTGACTGGAGCACTGAATACGCGGTCATTGGCGGTTTGCGCAGGCGTTTGGACTTGGCGCACACCAAGCTGGCGGCCAGCCGGGCGTTTGT
GCTGTCGGCCTATTACAACCAGGCGCACGAGATGCTGTTCGAGGCGCACGCCCGGGCCTTTGCCGTGTTTGGCGGGGTGACCAAGCGCGGGATCTACGAC
AACATGAAGACGGCGGTGGACAAGGTGGGGGACGGCAAGAAGCGCACCATCAACGCCCGCTTTGAGACGATGACGGGGCACTACCTGTTTGATCCCGAGT
TCTGCAACCGTGCAGCCGGCTGGGAGAAAGGCATTGTTGAGAAGAACGTTCAAGACCGACGCCGCGGCATCTGGCGCGAAGCCAGCGAGCGGCGCTGGAA
TTCACTTGAAGAGCTCAATGCCTGGCTGCAAAAGGCCTGTGTCGAGGCCTGGGAGCATCTACAGCATCCTGAGTGGGTGCACATGACGGTGGCCGATGTG
TACCAGGACGAGCGGCTGCGGCTGATGCCCAACCCCCGGCCCTTTGATGGCTACATCGAGCATCCGGCGCGGGTGTCCTCCACATCGTTGATCAGCTTCC
AGCGCAACCGCTACAGCGTGCCGTGCGAGTGGGTCAATGCCATGGTGAGTGTGCGGGTGTACCACGATCACCTGATGGTGGTCTCGCCAGATGGGGAGTT
CATCCGGATCAAGCGCTGCTTTGAGCGGGACCAGACGATCTACGACTGGACGCACTACATCGCGCTGATCGAGCGCAAGCCTGGGGCGCTGCGCAACGGC
GCCCCATTCAGGACGATGCCCGAGCCATTGCGGCAATTACAGGACCAGTTATTACGGCACCCGGGTGGCGATCGGGTCATGGCGCAGGTGCTCAATGCAG
TCACCTTGCACGGTCTGGAGGCGGTGCTGGTGGCCGTGGAGCTGGCCTTGCAGACTGGAAGGGTCAGCGCTGAGCATGTACTGAACGTCCTCTCGCGCCT
GAAGGAGCCCAGTCGCAACAACGAGCCGGTGCACACCCACCTGAGCCTGAACAAGCCATCACAAGCCAATGTGGATCGGTATGACCGACTGCGGGCCCAG
CAATGGAGAGATCAGGAGGTGAACCATGCTTGACATGATTGCTGACTTCAAGGAGTTGGGACTGCACGGCATGGCCAGTGCCTGGCCAGAGGTTCAAGGC
ACGGCCCGCATCAAGTCGCTGGACCACGAAACGGTGCTGATGCAATTGATCAAGGCCGAGAAGGCGCAACGCGAGGTGCGCTCCATGGCTTATCAGATGC
GTGTGGCCCGATTCCCGGCGCATCGTGATCTGGTGGGCTTCGACTTCACGCAGGCCCATGTTGATGAGGCCTTGGTCCAGAAGCTCCATGGGCTAGAGTT
TGTGAACTCAGCGCACAACGTGGTGTTGGTGGGAGGCCCTGGCACGGGAAAAACCCATCTGGCCACCAGTCTGGGCGTTCAGGCTATCCGTGCGCATGGC
AAACGCGTGCGGTTCTTCTCCACGGTCGAGCTGGTCAACGCCCTGGAGCTGGAGAAGGCGCAAAACAAGACGGGCCAGATGGCCTACAGGCTGATGTACG
TGGACATGGTGATCCTGGATGAGATGGGCTATCTGCCATTCACCCAGTCCGGTGGGGCACTGCTGTTTCACTTGCTCTCCAAGCTGTACGAGCGCACCAG
CGTGGTGATCACAACCAACCTGAACTTCTCGGAATGGAGCAATGTGTTTGGGGATGCCAAGATGACCACGGCCCTGCTGGACCGGCTGACGCATCACTGC
CACATCGTGGAGACCGGCAATGAGAGTTGGCGGTTCAAGCATTCAACGGCAGCCGCCACACCCACCAAACCTCAGCGGGCAAAAGCCCAGAAAGGAGAAG
CCAAAGCCCCAGAGCAGATAGACTTATCCACAACCAACTGAacaaaacttccctaaaaccagtggctcaatattcaacgtgaacactggctcagtttggc
tgatgaatCAACA
Protein section
ORF number : 2

 

ORF 1
LengthBeginEndStrandFusion ORF
1530 bp509 aa1041633+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MINVSTLSKLRRLVLRDNVSIREASRQLGISRNTAKKWLEQSEMVEPRYPKRASGPGILGPYEEVLTQWLKSDSHRNKRERRGTKALFEGLRALGYPGSR
GPVYTFALRWRKEQDLAAKGQGYVPMHFDMGEAFQFDWSTEYAVIGGLRRRLDLAHTKLAASRAFVLSAYYNQAHEMLFEAHARAFAVFGGVTKRGIYDN
MKTAVDKVGDGKKRTINARFETMTGHYLFDPEFCNRAAGWEKGIVEKNVQDRRRGIWREASERRWNSLEELNAWLQKACVEAWEHLQHPEWVHMTVADVY
QDERLRLMPNPRPFDGYIEHPARVSSTSLISFQRNRYSVPCEWVNAMVSVRVYHDHLMVVSPDGEFIRIKRCFERDQTIYDWTHYIALIERKPGALRNGA
PFRTMPEPLRQLQDQLLRHPGGDRVMAQVLNAVTLHGLEAVLVAVELALQTGRVSAEHVLNVLSRLKEPSRNNEPVHTHLSLNKPSQANVDRYDRLRAQQ
WRDQEVNHA

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
807 bp268 aa16352441+No
ORF function : Accessory Gene
AG : IS21 helper

ORF sequence :

MIADFKELGLHGMASAWPEVQGTARIKSLDHETVLMQLIKAEKAQREVRSMAYQMRVARFPAHRDLVGFDFTQAHVDEALVQKLHGLEFVNSAHNVVLVG
GPGTGKTHLATSLGVQAIRAHGKRVRFFSTVELVNALELEKAQNKTGQMAYRLMYVDMVILDEMGYLPFTQSGGALLFHLLSKLYERTSVVITTNLNFSE
WSNVFGDAKMTTALLDRLTHHCHIVETGNESWRFKHSTAAATPTKPQRAKAQKGEAKAPEQIDLSTTN

 

Blast result :
Comments
ISLisp1 is 77% (transposase) and 84% (helper) aa similar to ISCsp4.
References
1] Thomas Jové (2016) Direct submission
2] Zeng Y, Kasalický V, Šimek K, Koblí┼żeka M. J Bacteriol. 2012 Nov;194(22):6302-3. doi: 10.1128/JB.01481-12.