ISHsr2

  • Family IS1595
  • Group ISH4
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
ALJD01000012 ND Halogranum salarium
Halogranum salarium B-1
DNA section
IS Length : 1047 bp

Ends


IR Length : 27/34

IRL : CGCTCTTGTGTAGAGCTGCGGAACGACCGTGTAGTTACGGTGAACAAGCC
IRR : CGCTCTTATGTAGAACTCAGGAGTGACCCTGTAGCAAGGCAATCGACGAC

Insertion site


Left flankDirect repeatRight flankDR Length
AGTTCGACAGCCTTGACCTACGAAGAGTATGCC0

DNA sequence

CGCTCTTGTGTAGAGCTGCGGAACGACCGTGTAGTTACGGTGAACAAGCCGAAATCTTGAGGTTATGCCTCAGACTCAACCAGCGTTCGGCGGGATGCTT
CGCCAGCTCGTTGATCTTGGATTGTTTGAGTTCGACACTGAGCCGCTCGATATCGTCATCGAGCGGCGACTCAAGGAGTTCTGGAAGTATACCACGTGTC
CTCGCTGCGACCATCCCAGCATCCACACGTGGGAATCGTCCGACCGTGTTATTTGTCGAAACTGCGATTTCAAACCGGTTTACACCTATGGGACGCCCTT
TCACGAGAAACACCTCTCCTGCGGTGAGGTGCTTCTCGCGTACCTCCTCTATGCAGACACGTTGCTCAGTATCTCTCAGATTGCGGTTGTCCTTGACAGG
GCGTACAAGACCGTCTACTACACGATTCGAGAGGTGGAAGCCGCGGTCACGCGCGGCTTCCCCCTCGTCTGGGAGCAGTTCCAACACGCTATCTCTGGAC
CAACGCAAGTTGACGAGTCGAGCACGGTGTGTTCGGGCTACAAAGGCCAAGACCCGCCGCGGAACAGCCGGTACCGCGGCGGGTCGTCTCGATCAGAGCG
CTCACGATGGAAGGGACGTCACGGCGACCAGATAACGCTCATTGCGGCCTGCCGCGACGAGCTTCGGGTCATTCGCGGTCATCGTGGAATCGATTTTGAG
ACGGACTTAGCGCCGGTCATGCAGGAGGCTGAAGACCTCTCCCAGCCGCTGGGAGAGGTCTGGACCGACGGTCTCCAAGCGTACCGGCGAATGGAGTACG
ACCATCGAATCGTTGTCCACGACGAACGGTACGTTTCTGCTGACGGCGTCCACATCAATCAGGTTGAGTGTCTCTTCTCGCTCGTGAAGCCATGGCTGCG
GAAGTTCCGCGGCCTGTCCAAGCAGGGCTTGGAGCAGGCCGCTCACACCTTCGGACTCATTCGCTCGTTGAGCCTCGTCGGCGCATCCCTCGAAATCGTC
GTCGATTGCCTTGCTACAGGGTCACTCCTGAGTTCTACATAAGAGCG
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
978 bp325 aa651042+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MPQTQPAFGGMLRQLVDLGLFEFDTEPLDIVIERRLKEFWKYTTCPRCDHPSIHTWESSDRVICRNCDFKPVYTYGTPFHEKHLSCGEVLLAYLLYADTL
LSISQIAVVLDRAYKTVYYTIREVEAAVTRGFPLVWEQFQHAISGPTQVDESSTVCSGYKGQDPPRNSRYRGGSSRSERSRWKGRHGDQITLIAACRDEL
RVIRGHRGIDFETDLAPVMQEAEDLSQPLGEVWTDGLQAYRRMEYDHRIVVHDERYVSADGVHINQVECLFSLVKPWLRKFRGLSKQGLEQAAHTFGLIR
SLSLVGASLEIVVDCLATGSLLSST

 

Blast result :
Comments
ISHsr2 is 95% aa similar to ISHvo6.
References
1] ISfinder annotation (2016).
2] Kim,K.K., Lee,K.C. and Lee,J.S. (2012) J. Bacteriol. 194 (23), 6659.