ISLesa1

  • Family IS1595
  • Group ISPna2
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
DF968183 ND Lentimicrobium saccharophilum
Lentimicrobium saccharophilum TBC1
DNA section
IS Length : 1094 bp

Ends


IR Length : 20/23

IRL : GGCTGTAGTTTAGAATAGCGTTGTATTATGAAAATATTGTTTATCTTTGC
IRR : GGCTGTAGTTTATAAGTGCGTTGCTTTTAACGTTTGATATTTCTCTCCAA

Insertion site


Left flankDirect repeatRight flankDR Length
CAGCATTTTCATATGAAACTATAAATAA8

DNA sequence

GGCTGTAGTTTAGAATAGCGTTGTATTATGAAAATATTGTTTATCTTTGCTCAAACTACTTGCTAATGGACTATCAAGAAATATTATCAGCCATTCGCGC
CTTACCCTCGCACCAACAGGCGAACCTGATTGCAGAATTAACGGGGAACGAAAGTGCCCCCGACTACCTATCATTACGCAGAAACCAACTGATAAACAAG
CAGGTTGGCTGTCCTCATTGCGGAAGCCTAAGGTTTTACAGATTTGGCAAGGATAAGGGCAGCCAACGCTTTAAATGCAGAGCTTGCAGTCGAACATTTA
CGGAGTACACGGGCACATGGCTAGCTGGTCTGCATAAGAAAGAGCTTGTTAATGATTACCTTGAACTGATGCATAAGTCCATGTCATTGGATAAAATAAA
GTTTGCTCTGAGCATTAACAAGAAAACAGCCTTTGATTGGCGTCATAAAGTGCTTTCCTCTCTCGAAGAGGTAAGGAAGGATGATTTCAACGGGATTGTT
GAGAGTGACGAAACATTCTTTTTGCTGTCAGAAAAAGGGAAAGAACAGCAAACAAGGAAAGGTCGCAAGCGAGGGGGTAGCTCCTCTTCAAGAGGTGTTT
CCAAAGACCAGGTGGCTGTAATCGTGACGTCTGACCGTAAGGGGGCGATGGATATGAAGGTGGTCACCCTCGGGCGCATCAGCAAAGCTGACATCGAGAA
CGCCATTGGGAACCGAATTGAAAAGGACTCCATCCTATGCGCTGATGGGCACGTAAGCTATAAGGGCTTTGCCAAGGATAACCAGCTTTCATTGGTGGTG
CTACGCGCAGACCTTAAGCAATATGTTAAGAATGGCATCTATCACATACAAACCGTAAACTCTTTGCATAATCGAGTGAAGAAGTGGATTGACTCAACGT
TTTGGGGCGTCTCCACAAAATATCTTCAGAACTATTTAAACTGGTACAGAGTACAGCAAGCAGTCAAGAGCTCGCTTAGACCTACAGAAGAAGTCGTAAA
GTACACAACACTTGACCTTTTAAGTCTTACGAGATACCGAACAATTGGAGAGAAATATCAAACGTTAAAAGCAACGCACTTATAAACTACAGCC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1020 bp339 aa661085+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MDYQEILSAIRALPSHQQANLIAELTGNESAPDYLSLRRNQLINKQVGCPHCGSLRFYRFGKDKGSQRFKCRACSRTFTEYTGTWLAGLHKKELVNDYLE
LMHKSMSLDKIKFALSINKKTAFDWRHKVLSSLEEVRKDDFNGIVESDETFFLLSEKGKEQQTRKGRKRGGSSSSRGVSKDQVAVIVTSDRKGAMDMKVV
TLGRISKADIENAIGNRIEKDSILCADGHVSYKGFAKDNQLSLVVLRADLKQYVKNGIYHIQTVNSLHNRVKKWIDSTFWGVSTKYLQNYLNWYRVQQAV
KSSLRPTEEVVKYTTLDLLSLTRYRTIGEKYQTLKATHL

 

Blast result :
Comments
ISLesa1 is 69% aa similar to ISPto1.
References
1] ISfinder annotation (2016)
2] Tourlousse,D.M., Matsuura,N., Sun,L., Toyonaga,M., Kuroda,K., Ohashi,A., Cruz,R., Yamaguchi,T. and Sekiguchi,Y. (2015) Direct GenBank submission.