ISFoal1

  • Family IS1595
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
LMAK01000008 ND Formosa algae
Formosa algae KMM 3553
DNA section
IS Length : 984 bp

Ends


IR Length : 17/21

IRL : ATGTATATCCGTAATTAATCAAGTAGTATTAAAATGTATATTTATTTAAA
IRR : ATGAATATCCGTTTTTCATCACAATCCAGTAATACTAGCAATTACAAGCC

Insertion site


Left flankDirect repeatRight flankDR Length
AGTAATTATAAAATATTAAAAAAATATAATATAAAAGTTA0

DNA sequence

ATGTATATCCGTAATTAATCAAGTAGTATTAAAATGTATATTTATTTAAAATCTACTTTTATGAATATCTTTAGTTTTACAGCCCATTTTGATAGTGAAG
CATCTTGTATTTCTCATTTTAAATCAGAGAGAGATAAGATAGGAATTATATGTAAATGTGGTCATACCGAGCATTATTGGATAAAAAGTAAATTAAGTTA
TCAATGTAAAAAATGTAACAAGCGAAAGACTTTAAAGAGTGGTACCATTTTACAAGATTCTAACCTTCCTTTTATGGTTTGGTATAAAACTATTTTTTTA
ATGACAGCTACTAAAAAAGGCTTTTCTTCCAAGGAAATTCAAAAGCAATTAGGTTGGAAAAGATATGAACCTATTTGGGCTATGGTTCATAAATTACGTA
AGGCTATGGGTAATAGAGATGCTAAGTACACTCTTGAAGGAATGATTGAAATGGATGAAGGTTATTTTACTGTGGAATCCTCAGAATTAGAGCAATCTAA
GGGAGTTAGGGGACGTGGAGCTGTTGGAAAGAAGAATGTAGCTGTTATGGCTGAATCTACAGTATTAGAAGATACTCAAACAGGAGAAAAACAAAGACAA
GCTAGATATTTTAAAGCTAAAGTTTTAGAATCTCATCGAGCAGAGCACATCAACGAAGTGATTGAAGATTCTTTAGATGAAAAGAGTATTGTTTTTACAG
ATAAAAGTACATCTTATATAGATATTTCTGATTTTGTAGAGCTACATATTACTGAAAAATCTAACAAAGAAACCACTGAAAAAACCCTAAAATGGGTACA
TATTACAATTAGTAATGCAAAAAGAAATTTTCTTGGAAACTATCATAAGATTAAAGGAAAGTATCTTCAATTATACCTCAATGAATTTATATATAAACTC
AATCGTAGATATTTTGGAGAAAAGCTATTCGATAGGCTTGTAATTGCTAGTATTACTGGATTGTGATGAAAAACGGATATTCAT
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
906 bp301 aa61966+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MNIFSFTAHFDSEASCISHFKSERDKIGIICKCGHTEHYWIKSKLSYQCKKCNKRKTLKSGTILQDSNLPFMVWYKTIFLMTATKKGFSSKEIQKQLGWK
RYEPIWAMVHKLRKAMGNRDAKYTLEGMIEMDEGYFTVESSELEQSKGVRGRGAVGKKNVAVMAESTVLEDTQTGEKQRQARYFKAKVLESHRAEHINEV
IEDSLDEKSIVFTDKSTSYIDISDFVELHITEKSNKETTEKTLKWVHITISNAKRNFLGNYHKIKGKYLQLYLNEFIYKLNRRYFGEKLFDRLVIASITG
L

 

Blast result :
Comments
ISFoal1 is 90% aa similar to ISAlg2.
References
1] ISfinder annotation (2017)
2] Silchenko,A.S., Kusaykin,M.I., Menshova,R.V., Ustyuzhanina,N.E., Zakharenko,A.M., Zueva,A.O., Nifantiev,N.E. and Zvyagintseva,T.N. (2015) Direct GenBank submission.