ISPsy38

  • Family IS30
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
ND Pseudomonas syringae
Pseudomonas syringae
Pseudomonas syringae pv. actinidiae, strain ICMP9853
DNA section
IS Length : 1100 bp

Ends


IR Length : 21/28

IRL : GGCGGCGGCAAAAACTGAGCGCAACACCTGACCAATCCGGTACGGTGAAC
IRR : GGCGGTTTCAGAGGCTGAGTGCAACACCCGGCTATTGAGTTAGGGATGGA

Insertion site


Left flankDirect repeatRight flankDR Length

DNA sequence

GGCGGCGGCAAAAACTGAGCGCAACACCTGACCAATCCGGTACGGTGAACCTATGTCATATCATGAACTCAGCATTGAAGAACGCATCACGATCCAGTTT
GGCCAGCTCCAGGGCTTGAGTCAGCGAGCTATTGCCAAGGCGCTTGACCGAAGTCCTTCGACCATCAGCCGTGAGCTTCGCCGCAACAGTCCTGATGCCA
GCAGATACTCGGCCAATCAGGCCCATCAACACATGCGAAGTCGCCGAACCGTTTGCCGGCCCAATCGAAAACTGCTGCCGGGGAGCGAATTGTTCGAGCT
GGTCGTCTACCTGTTGCGAAAACGCTTTTCTCCTCAGCAAATTGCCGGCAAGCTCAACGCCATGGAATTCCCGAACTTTGAAGATACATACGTTTGTCGC
GAGACCATCTACAACGCCATTTACGCGCTGCCGGTGGGCGAGCTTCGCAAGGAGCTGATCATCTGTCTGCGACAAGGCAGAACCAGTCGGCGCCCGCGCT
CTGGCGAGGTTGATCGCCGTGGTCAGATTCCCGATTTGGTCAGCATCCATGTGCGTCCGCCTGAAGTGGAAGATCGCCAGATGCCTGGTCATTGGGAAGG
AGACTTGATCAAAGGCAAGGGCAATGCCTCCGCGGTGGGCACGCTGGTCGAACGCAGCACGGGCTACTTGATACTGGTCAAGATGAACGATGCGACAGCC
ACCTCTGCAGTCGAAGGTTTCAGCGCGGCCCTTAATCGCATGCCAGTGGCTGCTCGTAAAACACTGACCTACGATCAGGGCAGAGAGATGGCGCGCCACG
CCGAAATCACCCAGCGTACGGGTGTGGCGGTCTACTTTTGCGATCCTCACAGCCCGTGGCAGCGAGGCAGTAACGAAAACATCAATGGCCTGATTCGGCA
GTATCTGCCCAAGGGAACGGATCTGTCGGGGCCTGATCAGGAGCAACTGGATGCTATTGCGTACGAACTGAACATTCGCCCGCGCCAGCGTTTTGATTAC
AGATGCCCTATCGAAATGATGACGGCAATGATGTCCAAGCATCATGAGAGTCCATCCCTAACTCAATAGCCGGGTGTTGCACTCAGCCTCTGAAACCGCC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1017 bp338 aa531069+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MSYHELSIEERITIQFGQLQGLSQRAIAKALDRSPSTISRELRRNSPDASRYSANQAHQHMRSRRTVCRPNRKLLPGSELFELVVYLLRKRFSPQQIAGK
LNAMEFPNFEDTYVCRETIYNAIYALPVGELRKELIICLRQGRTSRRPRSGEVDRRGQIPDLVSIHVRPPEVEDRQMPGHWEGDLIKGKGNASAVGTLVE
RSTGYLILVKMNDATATSAVEGFSAALNRMPVAARKTLTYDQGREMARHAEITQRTGVAVYFCDPHSPWQRGSNENINGLIRQYLPKGTDLSGPDQEQLD
AIAYELNIRPRQRFDYRCPIEMMTAMMSKHHESPSLTQ

 

Blast result :
Comments
ISPsy38 is 88% aa similar to IS1394.
ISPsy38 is present on the main chromosome of Pseudomonas syringae pv. actinidiae, strain ICMP9853
References
1] Butler M. (2016) Direct submission to ISfinder