ISFps1

  • Family IS1595
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_009613 ND Flavobacterium psychrophilum
Flavobacterium psychrophilum JIP02/86
Flavobacterium psychrophilum 5
Flavobacterium psychrophilum MH1
Flavobacterium psychrophilum PG2
Flavobacterium psychrophilum VQ50
Flavobacterium psychrophilum 3
Flavobacterium psychrophilum FPG101
Flavobacterium psychrophilum CSF259-93
Flavobacterium psychrophilum V4-28
Flavobacterium psychrophilum V4-24
Flavobacterium psychrophilum V3-5
Flavobacterium psychrophilum 950106-1/1
Flavobacterium psychrophilum v4-33
Flavobacterium psychrophilum V2-20
Flavobacterium psychrophilum V1-20
Flavobacterium psychrophilum FPG3
DNA section
IS Length : 1045 bp

Ends


IR Length : 21/25

IRL : TATGACTATCCGTTACTTGTACCAATGCTGAAAAAAGTTTATATTTGAGT
IRR : TATGACTGTCCGTAACTAATACCAAGTTGTTTCTAAAGCAGCAATCATAA

Insertion site


Left flankDirect repeatRight flankDR Length
TTTAACTAAATTACTATAAACTAAAAATC8
CCAGAACAATAATAGATCATTAAATCATTATCAAACCATC0

DNA sequence

TATGACTATCCGTTACTTGTACCAATGCTGAAAAAAGTTTATATTTGAGTCATCAACCTATCAAATGCGAGCTATGAACCTGCCTGAATTTTTCGAGAAA
TATCCTGATGAAGCCTCATGTATTGAGGGATTCAAAGCCAAACGGCTTGAAATGGGAATTGTATGTAAAAAGTGTGAACACACAGAACATTACTTTCGCA
AGACAGATTTAAAATTTCAATGTAAAAAATGTGGTAGTCGCGTCAGCCTTCGTTCAGGTACTGTTATGGAGAATAGTAATTTGCCTTTTCAATATTGGAT
GCTCTGTATTGAACTGATGACTTTGTCAAAAAAGAGTTTTTCGGCATTAGAGATGCAACGTATGTTGGGACACAAGCGTTATGAACCAATTTGGTTTATG
ATGCACAAAATACGCCGAGTGATGAGTAAGCGTGATGAGAAATATCAATTAAAGGGCTGTATTGAATTTGATGAAGGATTCTTTGAAAGGGTTGACAACA
AAGATATTATCAAAGAAAAGGAAAACGAAAATAGTCAAAAATCTACTCCTAATAAACGAGGTCGTGGAAGTGAAAAACAAGCTAAAGTATTGGTAATGGT
TGAATCTGAACCCAGTATCTCTGCATCAAAAAAGGGTAAACCAAACAGAAAAGTTGGCTATCTAAAAATGGTAGTTGTGGAAGATTTGAAATCAGAAACT
ATTAATAAAGAGGTTGGGAAATCGGTAGACAAAACGGCATCTGTATTAAGTGATGGCTACACGGGATATGTTAAACTCAAAGAAGTTATAACAAATCATT
ATGTTGTAGTAGAACCAGACAAGCAAAAGTCGGCAAAGATATTTCCTTGGGTAAATAGAACAATCAGTAATGCTAAAAAAGTACTTTTAGGTATTCATCA
TAATTGTGTAAATCAGCAATATGTACAGAATTATCTTGACGAGTTCTGTTACAAGTTTAACAGACGGTATTTTGGGGACAAACTATCGGATAGACTTATG
ATTGCTGCTTTAGAAACAACTTGGTATTAGTTACGGACAGTCATA
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
966 bp321 aa651030+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MRAMNLPEFFEKYPDEASCIEGFKAKRLEMGIVCKKCEHTEHYFRKTDLKFQCKKCGSRVSLRSGTVMENSNLPFQYWMLCIELMTLSKKSFSALEMQRM
LGHKRYEPIWFMMHKIRRVMSKRDEKYQLKGCIEFDEGFFERVDNKDIIKEKENENSQKSTPNKRGRGSEKQAKVLVMVESEPSISASKKGKPNRKVGYL
KMVVVEDLKSETINKEVGKSVDKTASVLSDGYTGYVKLKEVITNHYVVVEPDKQKSAKIFPWVNRTISNAKKVLLGIHHNCVNQQYVQNYLDEFCYKFNR
RYFGDKLSDRLMIAALETTWY

 

Blast result :
Comments
ISFps1 is 70% aa similar to ISPba2.
References
1] ISfinder annotation (2017)
2] Duchaud,E., Boussaha,M., Loux,V., Bernardet,J.F., Michel,C., Kerouault,B., Mondot,S., Nicolas,P., Bossy,R., Caron,C., Bessieres,P., Gibrat,J.F., Claverol,S., Dumetz,F., Le Henaff,M. and Benmansour,A. (2007) Nat. Biotechnol. 25 (7), 763-769.