ISRan1

  • Family IS1595
  • Group IS1016
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
CP002562 ND Riemerella anatipestifer
Riemerella anatipestifer RA-GD
DNA section
IS Length : 815 bp

Ends


IR Length : 14/17

IRL : GGCTTAAGACTAGGAAACAATGATTAAATTTGTTGCTAAGTCTTATGAAT
IRR : GGCTCTAGACTAGCAAAGGTTTAAAATTTATAATTTTCACACTGTTGTTT

Insertion site


Left flankDirect repeatRight flankDR Length
TTAAATAAGTTTTAATAAAACAAAATAGG6

DNA sequence

GGCTTAAGACTAGGAAACAATGATTAAATTTGTTGCTAAGTCTTATGAATAGGAGTAAAATCAGCGATTATAAAATAAAAAAAATAATCAAGTGTTTTTG
TAGCGATATTGACGCAACGAAAACGGCGGAAATTTTAGAGTTCAACAGAAACACCATTAACCGATATTTTAGGATTTTTCGGGAAGTGATTTTTGAAAAA
CAACAAGCAGATTTGAGTTTGTTTTTTGGAGAAGTTGAATTAGATGAAGCCTATTTTGGAGCAAGGCGATTACGAGGGATTAATATGCCACAAAAACGAG
GAAGAGGAACTTGGAAACAACCTGTTTTTGGAGTTTTTGAAAGAGAAGGCAGGGTTTATACCGAACTGATTCCAAATGCAAAAAGTGAAACATTAAGAAA
AGTTATTCGAGGAAAAGTTTCATTAGAAAGTATTTTGTTTACAGATGGTTGGCGAGGTTATAGTGGACTTTTAGATATGGGATACGAGAAGCATTTCAGG
ATTGACAAGAGTAAAAATTTCTCAACTCAGAATGGTGTTCACATTAATGGAATAGAAAGTTTTTGGAGTTTCACCAAGCGAAGATTAGCTAAGTTTAATG
GGATAAAATCTACCTTTATATTACACTTAAAGGAATGCGAGTGGCGATGGAGAAAGGAAACTAAAGAAATGGAAAAAGAGTTATGGAAATTGATAAAAAA
ATATGGATAACTTTTTTAACGACTTCGTCTAAAAGTTACCCACATTTTTTTATTTTTACAACAACAAACAACAGTGTGAAAATTATAAATTTTAAACCTT
TGCTAGTCTAGAGCC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
678 bp225 aa33710+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MLSLMNRSKISDYKIKKIIKCFCSDIDATKTAEILEFNRNTINRYFRIFREVIFEKQQADLSLFFGEVELDEAYFGARRLRGINMPQKRGRGTWKQPVFG
VFEREGRVYTELIPNAKSETLRKVIRGKVSLESILFTDGWRGYSGLLDMGYEKHFRIDKSKNFSTQNGVHINGIESFWSFTKRRLAKFNGIKSTFILHLK
ECEWRWRKETKEMEKELWKLIKKYG

 

Blast result :
Comments
ISRan1 is 76% aa similar to ISAcra1.
References
1] ISfinder annotation (2017)
2] Yuan,J., Liu,W., Sun,M., Song,S., Cai,J. and Hu,S. (2011) J. Bacteriol. 193 (11), 2896-2897.