ISPros1

  • Family IS1595
  • Group ISSod11
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
MNWQ01000059 ND Propionibacterium sp.
Propionibacterium sp. CG1_02_60_36
DNA section
IS Length : 1040 bp

Ends


IR Length : 27/35

IRL : GGGGGATATCCACTTGAAGCAAGTGCCTACTACATGTAGTATGGGGTCAT
IRR : TGGGTGTATCCACTTGACGCAAGTAGCCCCTACATCTTGTGGTGACCGCC

Insertion site


Left flankDirect repeatRight flankDR Length
TTTTCTACCTTAAGCGGTAATACAGGAATTTAGGAGCTGA0

DNA sequence

GGGGGATATCCACTTGAAGCAAGTGCCTACTACATGTAGTATGGGGTCATGGGAACGCTGTCCAGACCGGTTGCGGGCGTCGATTACCCGCGGGACTTTC
AGGAATTCGACCGCTGGTTCGCGGATGAGGCCGCCTGCCGGACTTACCTCTTGCGCGTCCGGTGGCCGGAGGGCTACCGGTGTTTTCGTTGCGGATGCAT
GGAGCGGCCTTGGACAACCGCGCGAGGTTATCTGCATTGTCGAGGGTGTGGCGGAGAGGTCTCGGTTACGGCGGGCACCGTGTTCGAGGGCACGCGCAAG
CCCTTGCGGTCCTGGTTTCAAGCGATGTGGCGGGTGACGAGTCAGAAGCATGGTGCGAGCGCCTTGGGCCTTCAACGTGTGCTCGGGCTCGGAAGCTATC
AGACGGCTTGGGCTTGGCTGCATAAGCTGCGGCGTGCAATGGTCAGGCCCGGCCGCGAGCAGTTGCGGGGAGCCATCGAAGTCGACGAGACGTATGTTGG
CGGCTCGGAGATGGGCGGAAAACGGGGGCGTGGCAGCGAGAACAAGGCGATCGTTGTGATTGCAGTGGAGATGCTCTCTCCAAAGGGGTTCGGTCGGGTT
CGGATGCGGCGCGTTCCGGATGTGTCCGGCACCAGCCTGGTGCCGTTCGTCTGCGATGTGGCAGAACCCGGCTCCGAGATTCGAACGGATGGCTGGGGAG
GTTATAACAACCTGCGAGACCATACGTACGCCCACCGGAAGACGGTGATTTCGGACAGCGGGGATCCGGCACACGTGGCTATGCCAGGTGTGCATCGGAT
CGCCGCGCTCTTGAAGCGCTGGCTGTTGGGCATCCACCAAGGGGCCGTGAGTAGCAAGCATCTGGACTACTACCTTGACGAGTACACCTTCCGATGCAAC
CGGCGCACATCTGGATCGCGCGGGATGCTGTTCTATCGACTGATGCAACAGGCGGTCGCGACCGCCGTCACTCCGTACCGAGACCTTGTGGGCGGTCACC
ACAAGATGTAGGGGCTACTTGCGTCAAGTGGATACACCCA
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
963 bp320 aa491011+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MGTLSRPVAGVDYPRDFQEFDRWFADEAACRTYLLRVRWPEGYRCFRCGCMERPWTTARGYLHCRGCGGEVSVTAGTVFEGTRKPLRSWFQAMWRVTSQK
HGASALGLQRVLGLGSYQTAWAWLHKLRRAMVRPGREQLRGAIEVDETYVGGSEMGGKRGRGSENKAIVVIAVEMLSPKGFGRVRMRRVPDVSGTSLVPF
VCDVAEPGSEIRTDGWGGYNNLRDHTYAHRKTVISDSGDPAHVAMPGVHRIAALLKRWLLGIHQGAVSSKHLDYYLDEYTFRCNRRTSGSRGMLFYRLMQ
QAVATAVTPYRDLVGGHHKM

 

Blast result :
Comments
ISPros1 is 72% aa similar to ISAisp8.
References
1] ISfinder annotation (2017)
2] Probst,A.J., Castelle,C.J., Singh,A., Brown,C.T., Anantharaman,K., Sharon,I., Hug,L.A., Burstein,D., Emerson,J.B., Thomas,B.C. and Banfield,J.F. (2016) Environ Microbiol. Apr 26. doi: 10.1111/1462-2920.13362