ISDuph1

  • Family IS1595
  • Group ISSod11
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
LROM01000098 ND Duganella phyllosphaerae
Duganella phyllosphaerae T54
DNA section
IS Length : 1092 bp

Ends


IR Length : 23/27

IRL : CAGGGGTATCCACTTAGCTCCAATAATGATAATATCACTGTATGGATATC
IRR : CGGGATATCCACTTAGCTCCACAAATATCAAACTACTGTACTTACATCCA

Insertion site


Left flankDirect repeatRight flankDR Length
TTTTATACTGTATGTAAAAACAGGTGGGGC10

DNA sequence

CAGGGGTATCCACTTAGCTCCAATAATGATAATATCACTGTATGGATATCCATATATTAGCCCCGAAAGCGGGCGCTGACTACCCCACCCATTGGAATGA
ATTTCTGGTCTGGTTTGCCACCGACGAGGCCTGTCTGGCGTACCTGGAAAAATTGCGCTGGCCAGCCGGATTCGTTTGTCCCGCGTGCGACTGCGCCGAT
CACCCGTATCGCTCCAGTCGTGGCCGCATGGTATGCCGCCACTGCGGTCATCAATGTACCGTCACCGCCGGAACGATCTTCGAAAAAACACGCACGCCGC
TGCGCGTGTGGCTTGCTGCGGCATGGTATGCGACGAGCCAGAAACAAGGCGTCAATGCCCTTGGATTGCAGCGTGTGCTTGGCTTGGGTAGCTACCAGAC
TGCCTGGACGATGCTGCATCGTTTCCGTGCCGCGATGGTGCGCCCGGGGCGCGAAAGCCTTCATGGAAAAGTCGAAGTCGACGAAACCTACTTGGGCATC
AGTGACCGTCAAAAGCCGATCATCGCCAAGGGGGGCAAGAACAATACCGCTAAGACGCTCATCGTTATTGCGGTGGAAATGCTGGAACCGAAAGGCTTCG
GGAGAATTCGTTTGCAACGCATTCCGGATGACACCGCCGGCAGTGTGCTGCCGTTCGTGCAGCAAGGCATAAAGCCGGGCTCCACCGTGCATACGGATGG
CTCGGCAGCCTACCGTGCACTGACCGAGCTCGGTTACCTCCATCAACGCACCGTGATGCTCGAGTCGGACGTTGCCGCCCACGTTTCCATGCCCGGCGTG
CACCGAGTCGCTGCGCTGCTTAAGCGCTGGATTTTGGGTACTCACCATGGGGCTATCCAGCCTGCCCATGTGGACGCTTATCTGGATGAATTCGTGTTCA
GATTCAATCGTCGCAGTTCAAGTTCACGCGGCATGCTGTTTTATCGGTTGCTCCAGCAAGCCGTCGTGACGGGGCCCGTTACCTACGACGACGTCGTTCA
AAAAAGCGCGCTTGGGCAAGAAATTTGAAGTAATATCAGTGCTGGATGTAAGTACAGTAGTTTGATATTTGTGGAGCTAAGTGGATATCCCG
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
987 bp328 aa421028+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MDIHILAPKAGADYPTHWNEFLVWFATDEACLAYLEKLRWPAGFVCPACDCADHPYRSSRGRMVCRHCGHQCTVTAGTIFEKTRTPLRVWLAAAWYATSQ
KQGVNALGLQRVLGLGSYQTAWTMLHRFRAAMVRPGRESLHGKVEVDETYLGISDRQKPIIAKGGKNNTAKTLIVIAVEMLEPKGFGRIRLQRIPDDTAG
SVLPFVQQGIKPGSTVHTDGSAAYRALTELGYLHQRTVMLESDVAAHVSMPGVHRVAALLKRWILGTHHGAIQPAHVDAYLDEFVFRFNRRSSSSRGMLF
YRLLQQAVVTGPVTYDDVVQKSALGQEI

 

Blast result :
Comments
ISDuph1 is 86% aa similar to ISVasp3.
References
1] ISfinder annotation (2017)
2] Haack,F.S., Poehlein,A., Kroger,C., Voigt,C.A., Piepenbring,M., Bode,H.B., Daniel,R., Schafer,W. and Streit,W.R. (2016) Front Microbiol 7, 1668.