ISPmi3

  • Family IS1
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
ND Proteus mirabilis
Proteus mirabilis
DNA section
IS Length : 783 bp

Ends


IR Length :

IRL : GGTTATGTATCCAATCCGGTGATTAACCTGTAATATAGGGTAATTTACCG
IRR : GGCCATGTATTCAATATGTAGATCATCATAATAGGTAGTGTTCGCGTTCA

Insertion site


Left flankDirect repeatRight flankDR Length

DNA sequence

GGTTATGTATCCAATCCGGTGATTAACCTGTAATATAGGGTAATTTACCGGAGAATAGTCATGGCTAAAGTCGATGTAAGGTGCCCATTTTGTCAACAAA
CTCCCTCAGTAAAAAAACATGGATTAGGAAGCACTGGCCATCAACGCTATCGTTGTCAAGATTGCTGTCGAAGCTTTCAACTCGATTATGAATATCGCGC
CTGCCAACCTGGGACTAAAGATAAAATTATCGATCTTACGATGAATAATGCCGGTATTCGTGATACCGCTAGAGCCCTTCATATCAGCATTAATGCGGTT
GTTCGTACTTTAAAAAACTCTCGCCGAGGCAGGTAACCTCTTTACCTCTTGATAATCTGCATATTGAACTTCTTTGTGAAGTGGATGAACAGTGGTCTTT
TGTTGCTAGCAAGAAGCAACAACGCTGGCTCTGGTATGCTTGGGAACCTCGCCTAAAACGAATTATTGCTCATACATTTGGTCGTCGAAATAAGAAAACG
CTTCACCAGTTATTGGTATTACTCTCTAGATTTAATGTGGCTTTTTGGTGTACCGATAAGTTTAATGCTTATGAGATATTGCCGAAGGAAAAACACGTAG
CCAATAAGTTTTATACACAACGAATTGAACGTGAGAACTTAAACCTAAGAAACCGTTTAAAGCGACTTAACCGTAAAACGTTAAGCTACTCAAAGTCAGC
AGAAATGCACGACAAGATCATCGGCACGTTTATTGAACGCGAACACTACCTATTATGATGATCTACATATTGAATACATGGCC
Recoding section
  • Recoding by frameshift
  • Frame -1
  • Type translational
  • Experimentally demonstrated No

Stimulators :

  • Shine-Dalgarno sequence :
  • Secondary structure :

Recoding motif :

Protein section
ORF number : 3

 

ORF 1
LengthBeginEndStrandFusion ORF
276 bp91 aa61336+No
ORF function : Transposase
Description : First part of the transposase

ORF sequence :

MAKVDVRCPFCQQTPSVKKHGLGSTGHQRYRCQDCCRSFQLDYEYRACQPGTKDKIIDLTMNNAGIRDTARALHISINAVVRTLKNSRRGR

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
465 bp154 aa294758+No
ORF function : Transposase
Description : Second part of the transposase

ORF sequence :

CGCSYFKKLSPRQVTSLPLDNLHIELLCEVDEQWSFVASKKQQRWLWYAWEPRLKRIIAHTFGRRNKKTLHQLLVLLSRFNVAFWCTDKFNAYEILPKEK
HVANKFYTQRIERENLNLRNRLKRLNRKTLSYSKSAEMHDKIIGTFIEREHYLL

 

Blast result :
ORF 3
LengthBeginEndStrandFusion ORF
698 bp232 aa61758+Yes
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MAKVDVRCPFCQQTPSVKKHGLGSTGHQRYRCQDCCRSFQLDYEYRACQPGTKDKIIDLTMNNAGIRDTARALHISINAVVRTLKKLSPRQVTSLPLDNL
HIELLCEVDEQWSFVASKKQQRWLWYAWEPRLKRIIAHTFGRRNKKTLHQLLVLLSRFNVAFWCTDKFNAYEILPKEKHVANKFYTQRIERENLNLRNRL
KRLNRKTLSYSKSAEMHDKIIGTFIEREHYLL

 

Blast result :
Comments
ISPmi3 is 89% aa similar to ISYps7.
The third ORF is a putative ORFAB transposase reconstructed in silico by possible -1 frameshift.
References
1] Papagiannitsis Costas (2017) Direct submission to ISfinder