ISHahy9

  • Family IS30
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
CP002304 ND Halanaerobium hydrogeniformans
Halanaerobium hydrogeniformans
DNA section
IS Length : 1217 bp

Ends


IR Length : 20/30

IRL : GCTTAATTGTAAAATGAACTTGAACTAATTAAAAAAAACTAATAAAAAAT
IRR : CTTGAATTGCAATGTTAAATTGAACTAGTTTCAAACTGTAATAATTTTAA

Insertion site


Left flankDirect repeatRight flankDR Length
ATAATCTCCCCATTCATAAAATATTATAATCAATTTTTAACAAAATT13
TTTTCGAAAAAATATTTGATAATAAAAAAGGAATAAAAAGAGTTTTA9
AAAATGAGATA(T/a)TTTATTAAGATAATTTATTAAAAATAAA13

DNA sequence

GCTTAATTGTAAAATGAACTTGAACTAATTAAAAAAAACTAATAAAAAATGCCCATAGTGGCACAAACTGTAATATAATTGAATTACTACAAACAATAAA
CATTACAGGAGGGTGCACACTATGGACTACTTATATGATACACCAAATTCTCGAAAAAATAAACACCTTAATGCTTATGATCGCGGTCAAATTGCTTTAT
TACATTCAGAAGGAATGTCACCTTATGCAATTGGTAAACGCTTAGGTAGAGCTTCAAATACAATTAGAAACGAGTTGAAACGTGGTACAGTTTCTCAAAT
AAAGGCCAATAAAAAGGTTGATATTTATTTCCCTGATGTTGGTCAAAGAGTTTATGAAAATAATCGTAAAAATTGCGGACCTAAGTTTAAACTCCTAGAG
TGCGAAGATTTCATAGAACATGTTTTAGATAAATTTTACAACTCAGATCATTCAATTGATTCTATTTGTGGATCAGCTCAGGTGCATAATAAATTTCCAA
ATTCAAAGATGGTTTGCACCAAAACTCTCTATAATTACATAGATGCTGGACTACTTAAGATTAAAAATATTGATCTACCATTGAAATTAAAGCGTTCTAC
AAAACCAAAACGTATTAAGCAGAATAAAAAGAAACTGGGTACCAGCATTGATGAACGCCCTGAAAGCGTTAATGATCGCAGCGAATTTGGCCACTGGGAA
ATTGATACTATTATTGGTAAAAAGACTAAAGATGAAGCAGCACTACTTACTATGACAGAACGTACAACTCGCTCACAAATTATTCGCAAAATTGATGACA
AAACATCTTGTTCTGTTCAGGAAGCTATGACAAAGCTAATCAAAGAAACTGGAGATCTTTTTTCTACAGTCTTTAAAAGCATTACCAGTGACAATGGTTC
TGAATTCTCAGAGCTAGCCAGTGTAGAAGAAATAGTTGGCACTAAAATTTATTATACTCATCCCTATTCAGCCTGGGAAAGAGGAACAAATGAACGTCAC
AATGGCTTGATAAGAAGGTTTATACCTAAAGGTAGAAGTATAAATGAATTTTCAATTGAAGCTATTGCTAGAGTTCAAAATTGGTGTAATACTTTACCTA
GAAAAATATTAGGATATTTAACTCCTGATGAAGCTTTTGAAGACCAACTAAAACTAATTCTATACAATTAAAATTATTACAGTTTGAAACTAGTTCAATT
TAACATTGCAATTCAAG
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1050 bp349 aa1221171+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MDYLYDTPNSRKNKHLNAYDRGQIALLHSEGMSPYAIGKRLGRASNTIRNELKRGTVSQIKANKKVDIYFPDVGQRVYENNRKNCGPKFKLLECEDFIEH
VLDKFYNSDHSIDSICGSAQVHNKFPNSKMVCTKTLYNYIDAGLLKIKNIDLPLKLKRSTKPKRIKQNKKKLGTSIDERPESVNDRSEFGHWEIDTIIGK
KTKDEAALLTMTERTTRSQIIRKIDDKTSCSVQEAMTKLIKETGDLFSTVFKSITSDNGSEFSELASVEEIVGTKIYYTHPYSAWERGTNERHNGLIRRF
IPKGRSINEFSIEAIARVQNWCNTLPRKILGYLTPDEAFEDQLKLILYN

 

Blast result :
Comments
ISHahy9 is 70% aa similar to IS1470.
References
1] Bassett K. (2017) Direct Submission to ISfinder
2] Brown S.D., Begemann M.B., Mormile M.R., Wall J.D., Han C.S., Goodwin L.A., Pitluck S., Land M.L., Hauser L.J. and Elias D.A. (2011) J. Bacteriol. 193, 3682-3683