ISLmo7

  • Family IS21
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
CP006611.1 ND Listeria monocytogenes
Listeria monocytogenes
Listeria monocytogenes strain FDA00006907
DNA section
IS Length : 2164 bp

Ends


IR Length : 41/50

IRL : TGTAAAGGGCCATATTAAAATGTAGGAAAAGGGCCATCGAAAATGTAGGT
IRR : TGTCAAGGGCCATATTAAAATGTTGGTTTTAGGCCACTGAAAATGTAGGT

Insertion site


Left flankDirect repeatRight flankDR Length
atgatcatatgaaaaccatg0

DNA sequence

TGTAAAGGGCCATATTAAAATGTAGGAAAAGGGCCATCGAAAATGTAGGTACATGACAAATCTGATATTCTTTTTCATGAAACTATCCAAGGAGAGTGAA
TCATGAGAAAAGATGTCTTAGAAGGAGTGTTACTACACATTATGAATGAAATTCATCCTAATTTCGCAGCCCTTGCCAAACAATATAATTGTGATTATCG
AACGGTTAAACGCTATTATGAAGCTGGATTGAAGGGGGATTTAGATAAGCTTAGAGAGAGAAAACCTTCGGTCCCTCCTTTGCTTCATGGTTTTGAAGAA
ATTATTCGTGATAAATTAGAATTAAATTGTTCGGCAGCTTCTATCTTTTATTTCTTAGGTAAAAAAGGTTATAAAGGGAGTTATACAACGATTAAACGTT
ATTGTCGTAAATACCGGGAAGAAAAAGTACAAAAAGCAACGATTCGTATTGAGACCACACCCGGTCTTTCTGCTCAAGTAGATTGGAAAGAAAACGTTAA
AATGGTTAGCCGAGACGGTGAAGTGTTTTATTTCAATATTTTTCTCTATATTCTTGGTTACTCAAGAATGAAGTACTTAGAGCTCACTTTTGATCGAACA
CAACCGACGGTTTTTCAGTGTTTAGTCAATGCCTTTGAATATTGCGGAAACGGTATTCCTCAAGAAATTTGGTTTGACAATATGAAAACCGTTGTCGACC
GTAGTAAGAGTCAATTCACACAAACTGTTTTCAATGAAAAATTCCGGCAATTTGCGAAAGATGCTGGATTCCATCCGATTGCTTGTCGTCCTTTTAGACC
CCAAACAAAAGGGAAAGTGGAAGCATTAGCCCGAACAGTTGAGCGTTTAATGGTCTTTAATTATGAATTTACAGATGTACAAGAGTTAAAACAGATCATA
TATGAATTGATGCAAGATCTGAATGGCTCCGTCTCACAAGCCATCCACAACAAACCGACGGTTTTACTAAAGGAAGAGCTTCCCATACTAGCTCCCATCC
ATCGTTTAGAATTGCTCAGCTATGTTTCTAGAAATAAACGTCTACTGAGAAAGGTATCGATGGAGTCCATGGTTCAATATCAAAATGCTAAATATTCTGT
TCCTGTTAAATATATTGGGAAAGAAGTGACGTTAGATATTCGTAGGGACAATCTATTTGTTTGGTATGGGGATAAATGTATTCGAACCCATCCTATAAGT
GAAAAAGCGCTTAATTATCAACGCGAAGACTCGCTTGAAATTTTGCGTTCCGATGTATTTAAATATTTAGAAGATGAAGAATTAGAGCGATTTGTCGATG
ATAATTTACATGCATATGACGATCTATAAGGAGGAAATGATGTCCCATTACCATCAATTGTTAAATCAACTAAACGAATTGAATTTATCTTGCATGAAAG
AAAATCTACCTGCCCATTTAGATGAGGTTGCCAAAAGTGATAAATCGCTTGTAGACTCTTTATTCGAGCTCACCCAACAAGAAATTAGTTATCGTAAAAA
AGAAAGTCAAAAAAAGGTATTAAAGCGTGCAATGTTCCCCTACCACAAACGACTCCATGATTTCAATTTTGATTTTCAACCAAGGATAAAAAAGAAGGAA
ATGCAGGATTTATTAACATTACGCTTTTTAGACACATATGACAATATTCTCTTTATTGGAAATAGTGGTGTTGGAAAGACCCATTTAGCCGTTTCAATTG
GATTAGAATGTATCGATCGTGGTTTAAGTTGTTTGTTCATTACGAGCACTGAATTAGTGAATCGTTTGATCCGCGCTCACAAGCGCGGAACTAGCGAAAC
GATGCTAAAAAAATATTCGGGTTATTCGGTGTTGATTATCGACGAAGTCGGCTATTTACCTTTCTCCAAAGAAGGTTCCAACTTACTTTTTCAGCTGATT
AATATGCGGTATGAAAGAAAATCTACGATTGTTACAACCAATATCCCACTATCCCAGTGGTCCGAAATATTTGGAAACAAGAAGCTTACCAACGCGCTAC
TGGACCGGTTGGTCCATCACTCTAAATTGATCCAAATTACGGGGCCCTCTTATAGAATGAAGAGTTATAGCGAAAACAAAGAGGTGAAATCGTAAAAACG
TTTAAACGATTTTCACCTACATTTTCAGTGGCCTAAAACCAACATTTTAATATGGCCCTTGACA
Protein section
ORF number : 2

 

ORF 1
LengthBeginEndStrandFusion ORF
1227 bp408 aa1031329+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MRKDVLEGVLLHIMNEIHPNFAALAKQYNCDYRTVKRYYEAGLKGDLDKLRERKPSVPPLLHGFEEIIRDKLELNCSAASIFYFLGKKGYKGSYTTIKRY
CRKYREEKVQKATIRIETTPGLSAQVDWKENVKMVSRDGEVFYFNIFLYILGYSRMKYLELTFDRTQPTVFQCLVNAFEYCGNGIPQEIWFDNMKTVVDR
SKSQFTQTVFNEKFRQFAKDAGFHPIACRPFRPQTKGKVEALARTVERLMVFNYEFTDVQELKQIIYELMQDLNGSVSQAIHNKPTVLLKEELPILAPIH
RLELLSYVSRNKRLLRKVSMESMVQYQNAKYSVPVKYIGKEVTLDIRRDNLFVWYGDKCIRTHPISEKALNYQREDSLEILRSDVFKYLEDEELERFVDD
NLHAYDDL

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
756 bp251 aa13402095+No
ORF function : Accessory Gene
AG : IS21 helper

ORF sequence :

MSHYHQLLNQLNELNLSCMKENLPAHLDEVAKSDKSLVDSLFELTQQEISYRKKESQKKVLKRAMFPYHKRLHDFNFDFQPRIKKKEMQDLLTLRFLDTY
DNILFIGNSGVGKTHLAVSIGLECIDRGLSCLFITSTELVNRLIRAHKRGTSETMLKKYSGYSVLIIDEVGYLPFSKEGSNLLFQLINMRYERKSTIVTT
NIPLSQWSEIFGNKKLTNALLDRLVHHSKLIQITGPSYRMKSYSENKEVKS

 

Blast result :
Comments
ISLmo7 is 77% aa similar to IS712.
ISLmo7 was identified by in silico nucleotide sequence analysis of Listeria monocytogenes strain FDA00006907 plasmid pCFSAN021445.
ISLmo7 and ISLmo7 isoforms are present in many plasmids of L. monocytogenes and L. innocua strains.
References
1] Cora Chmielowska (2018) Direct submission.