ISPye4

  • Family IS1182
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
CP020442 ND Paracoccus yeei
Paracoccus yeei
Paracoccus yeei FDAARGOS_252
DNA section
IS Length : 1509 bp

Ends


IR Length : 17/18

IRL : GGGGTCGTTGAAAAAGCTATCTTTGAATGATTCACTGGCCTCAGATCGTA
IRR : GGGGTCGTTGAAAAAGTTGCTTCTGTGGCGACTGAATACAGATCGGGGCG

Comments : Insertion within another IS enabled precisely defining ends and DR's.

Insertion site


Left flankDirect repeatRight flankDR Length
gatcaggtgaACGATgcaggtctgg5
ccagacctgtATCGTccatctgatc5
gatcaggtgaACGATgcaggtctgg5

DNA sequence

GGGGTCGTTGAAAAAGCTATCTTTGAATGATTCACTGGCCTCAGATCGTAGCGGAGGCGGGCATGCTGGGTCGCAAGGAGCGGGATCAACTGGAGCTGTT
CATTTCAGGATCGCTTCGCCAACTTATTCCTGACGAGCATGTCCTGGTTCGGGTCGATGCTGTTCTCGACCTTACCTGGCTTCGCGACGATATTGCTGAT
CTCTACTGCGCCGACAACGGCCGACCGGGCATTGATCCCGAGGTTGCAGTTCGCTTGATGCTGGCAGGTTTCCTGCTCGGCATTGTCCATGACCGGCGAC
TGATGCGTGAGGCGGCGGTCAATATCGCGATCCGCTGGTTTGTTGGTTACGGGCTGCATGAGGCTCTGCCCGATCATTCGTCGCTGACGCGCATTCGCCA
GCGCTGGGGTGCCGAGCGTTTTCGCCGGATCTTCGAACGCACGGTTCAGGCCTGCGTCACCGCGAAGATCGCGACCGGAGAGATTGTCCATCTCGACGCC
TCCTTGATCCGCGCGCATGTGAGCTGGGATTCGCTTGCCGTCCGCCACGTAGAAGCGGTTGTCGATGCCAACGATGAAACGCTCCGCGAGAGCCGACAGA
CCGGCAGGTTCAAGAAAGTTTGCGTGACCGACCCTGACGCCACGATGGCCACGAACGGCCGCAATCGCCGCCTCGAACCGGCCTACAAGCAGCATACTGC
CGTCGATGACGTGGCAGGTGTCGTTGTCGACGTCGAGGTCACGACCGGCGAGGAAAATGAGGGTATGGTGATCGCCGGACGGCTCGATGCTGCGGCTACG
ACCACCGGCCGGGCGATCAGCATCGCGACGATGGATGCCGGCTATGCCTACGCCAAGGTGTTCCGGGTGCTTGAGGATCGCGAGATCGAAGCCATCGTTC
CCGCCAAGGCTGAACAGGCTCCAGGCAAAGTCATTCCTACGCGCCGGTTCAAGTTCGATGCCCGGCACAATCTTGCTCGCTGTCCGCAAGGCAAGATCCT
GCGGCCCAAAGGCAAGCTCCAGCGCGGTGCTTTCCAGTATTTTCATGCCCGCGCCAAGGACTGTGGCGGCTGCCCGTTGCGGGCTCGCTGTGTCAGCCCT
TCACGTCACGCCCGCGTCGTTGTGTTCAATGTCAACCATCCTTCGCTGCTCCGGGCGCGGCGCAGGCGGATTCGGTGGGGCGACCGCGAAGAACGCCTCT
ATCAGCGCCACCGCTGGCGGGTTGAGGGCGTCCATGGCGAAGCCAAGACTTGGCATGGCCTTGCCCGCGCCGTCCGGCGCGGGCTCGACAATATCCGCAT
CCAGGCTTTCCTGACGGCTGCCGCCATCAATCTCAAACGGCTCGCAGTTGCCTTGATCTTGTTGATTTATGCCGACTTGACGGCATACGCCGCGCCAAAT
CGACCCTGCGGGCGCCTCTCGGCTCTTAGGATCCGAAAAACGCGGGCTTCGGAGGTGAACGCCCCGATCTGTATTCAGTCGCCACAGAAGCAACTTTTTC
AACGACCCC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1447 bp482 aa631509+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MLGRKERDQLELFISGSLRQLIPDEHVLVRVDAVLDLTWLRDDIADLYCADNGRPGIDPEVAVRLMLAGFLLGIVHDRRLMREAAVNIAIRWFVGYGLHE
ALPDHSSLTRIRQRWGAERFRRIFERTVQACVTAKIATGEIVHLDASLIRAHVSWDSLAVRHVEAVVDANDETLRESRQTGRFKKVCVTDPDATMATNGR
NRRLEPAYKQHTAVDDVAGVVVDVEVTTGEENEGMVIAGRLDAAATTTGRAISIATMDAGYAYAKVFRVLEDREIEAIVPAKAEQAPGKVIPTRRFKFDA
RHNLARCPQGKILRPKGKLQRGAFQYFHARAKDCGGCPLRARCVSPSRHARVVVFNVNHPSLLRARRRRIRWGDREERLYQRHRWRVEGVHGEAKTWHGL
ARAVRRGLDNIRIQAFLTAAAINLKRLAVALILLIYADLTAYAAPNRPCGRLSALRIRKTRASEVNAPICIQSPQKQLFQRPH

 

Blast result :Comments : No STOP codon. The transposase use the first STOP codon in the insertion site.
Comments
ISPye4 is 82% aa similar to ISMno17.
ISPye4 was identified by in silico nucleotide sequence analysis of  Paracoccus yeei strain FDAARGOS_252 (there are 3 copies od ISPye4 present in the genome). The transposase does not have a STOP codon within the IS.
References
1] Chmielowska C., Szuplewska M., Bartosik D. (2018) Direct submission.
2] Goldberg,B., Campos,J., Tallon,L., Sadzewicz,L., Sengamalay,N., Ott,S., Godinez,A., Nagaraj,S., Vavikolanu,K., Aluvathingal,J., Nadendla,S. and Sichtig,H. (2017) Direct GenBank submission.